LXL04_015095 | RubberDandelionOmics

Gene overview

LXL04_015095

Reference: OH-1004 Chr: Chr03 Coordinates: 63374269-63376186 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

921 bp · LXL04_015095|LXL04_015095|OH1004|cDNA

ATGGCTAAATTATCTCTATCGATCTCTCTCTTAATACTCGCAATCTCGCAATTTTTCGTACAAGGAGTGATTTCGTCGGCGACGTTTACATTTGTGAACAAGTGTGATCAAACAGTTTGGccaggcattttatcgaacgCTGGGATTGCACCTCTTGAACCTACAGGTTTCGCTCTTCAAAAAGGCGAATCGAAGGTACTCAACGCGCCATCGTCTTGGGGTGGTCGGTTCTGGGGCCGAACACACTGTTCCGAGGATTC...

CDS

Download CDS FASTA

921 bp · LXL04_015095|LXL04_015095|OH1004|CDS

ATGGCTAAATTATCTCTATCGATCTCTCTCTTAATACTCGCAATCTCGCAATTTTTCGTACAAGGAGTGATTTCGTCGGCGACGTTTACATTTGTGAACAAGTGTGATCAAACAGTTTGGCCAGGCATTTTATCGAACGCTGGGATTGCACCTCTTGAACCTACAGGTTTCGCTCTTCAAAAAGGCGAATCGAAGGTACTCAACGCGCCATCGTCTTGGGGTGGTCGGTTCTGGGGCCGAACACACTGTTCCGAGGATTC...

Protein

Download Protein FASTA

306 aa · LXL04_015095|LXL04_015095|OH1004|PROTEIN

MAKLSLSISLLILAISQFFVQGVISSATFTFVNKCDQTVWPGILSNAGIAPLEPTGFALQKGESKVLNAPSSWGGRFWGRTHCSEDSDGKFTCGTGDCGSGKLECAGSGATPPATLAEFTLDGDGGMDFFDVSLVDGYNLPMLVAPSGGSGRNCTYTGCMVDLNGACPSALKVMSSDGDGVACKSACEAFGKDEDCCSGPYATPDTCKPSAYSQLFKTACPRAYSYAYDDKTSTFTCIGADYQVTFCPPPTTSKKSTEGQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015095`
TK1151 ID	TkA02G369460
OH-1004 ID	LXL04_015095
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 97.603 / OH-1004 92.810 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015095

Location Chr03:63374269-63376186 (-)

Description Similar to TLP1: Thaumatin-like protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g38280`	Possesses kinase activity in vitro.	The PR5K receptor protein kinase from Arabidopsis thaliana is structurally related to a family of plant defense proteins.1996 · DOI: 10.1073/pnas.93.6.2598
`At4g24180`	Involved in local responses of roots to colonization by non-pathogenic plant growth-promoting rhizobacteria (PGPR) fluorescent Pseudomonas spp., but does not seem to be required for the establishment of subsequent induced systemic resistance (ISR).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015095 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0009682 induced systemic resistance Biological Process

GO:0009723 response to ethylene Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT4G24180

ath:AT5G38280

mdm:103411735

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.377

Rank 1 · LXL04_015095 · OH-1004

Extracellular0.280

Rank 2 · LXL04_015095 · OH-1004

Endoplasmic reticulum0.150

Rank 3 · LXL04_015095 · OH-1004

Lysosome / Vacuole0.143

Rank 4 · LXL04_015095 · OH-1004

Cytoplasm0.128

Rank 5 · LXL04_015095 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00314.23Thaumatin33-248 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015095	`PF00314.23`	Thaumatin	33	248	2.9e-85	285.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FF29`	Arabidopsis thaliana	PR5-like receptor kinase	54.365%	Swiss-Prot	strong database homology
`A0A1P8B554`	Arabidopsis thaliana	Thaumatin-like protein 1	57.371%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card