LXL04_015091 | RubberDandelionOmics

Gene overview

LXL04_015091

Reference: OH-1004 Chr: Chr03 Coordinates: 63269263-63275315 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3105 bp · LXL04_015091|LXL04_015091|OH1004|cDNA

ATGCGTAATGCTGTTTCGCGATCGGTGGAGGGAGGAATGGTTCTCGTCGGTTTTTCGCAGAGGGAGAGAGTGGTTCACGAAATGGGGTGGGGGTCACGAAACAGACTGCTCTGCGGTTTAACTGATGTGCTGTGCGGTTTCGCAGAGCATGCCTCTGCGAAATGGAGTTTTTACTGCGAAATGGATTTCGCAGAGGCcaccctctgcgaaattgGACTCGAGAGTGGTCTGGTTTTATGGACCAAACACCACGGATTGCC...

CDS

Download CDS FASTA

3105 bp · LXL04_015091|LXL04_015091|OH1004|CDS

ATGCGTAATGCTGTTTCGCGATCGGTGGAGGGAGGAATGGTTCTCGTCGGTTTTTCGCAGAGGGAGAGAGTGGTTCACGAAATGGGGTGGGGGTCACGAAACAGACTGCTCTGCGGTTTAACTGATGTGCTGTGCGGTTTCGCAGAGCATGCCTCTGCGAAATGGAGTTTTTACTGCGAAATGGATTTCGCAGAGGCCACCCTCTGCGAAATTGGACTCGAGAGTGGTCTGGTTTTATGGACCAAACACCACGGATTGCC...

Protein

Download Protein FASTA

1034 aa · LXL04_015091|LXL04_015091|OH1004|PROTEIN

MRNAVSRSVEGGMVLVGFSQRERVVHEMGWGSRNRLLCGLTDVLCGFAEHASAKWSFYCEMDFAEATLCEIGLESGLVLWTKHHGLPDTNTFGVESNFKRTFSRLIYFKGSAFRRSLRTGSKMEIKSPAPCPKTVTVRRNPPRRARPTPSTVVPISAAPSSKTSSAIRSFPIHDILSIDIPEKEKEKQEIPEPSSPKEPSSSEKLKVFLRIKPIITQPKVGVSVKNAAHKNVWPQNPSKKKDASKTAKAVGKKSNEICLK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015091`
TK1151 ID	TkA02G369820
OH-1004 ID	LXL04_015091
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.400
Protein coverage (%)	TK1151 100.000 / OH-1004 92.553 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015091

Location Chr03:63269263-63275315 (-)

Description Similar to KIN6: Kinesin-like protein KIN-6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20060`	Kinesin-like protein KIN-6.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0101800`	Kinesin-like protein KIN-6.	No verified direct reference in this release
`Os11g0552600`	Kinesin-like protein KIN-7L.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015091 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000022 mitotic spindle elongation Biological Process

GO:0000070 mitotic sister chromatid segregation Biological Process

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0000278 mitotic cell cycle Biological Process

GO:0007018 microtubule-based movement Biological Process

GO:0007019 microtubule depolymerization Biological Process

GO:0007052 mitotic spindle organization Biological Process

GO:0007079 mitotic chromosome movement towards spindle pole Biological Process

GO:0008608 attachment of spindle microtubules to kinetochore Biological Process

GO:0010970 transport along microtubule Biological Process

GO:0030705 cytoskeleton-dependent intracellular transport Biological Process

GO:0033044 regulation of chromosome organization Biological Process

KEGG gene cross-reference

ath:AT1G20060

dosa:Os02g0101800

dosa:Os11g0552600

gla:GL50803_0016456

osa:4327984

spo:2540361

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.784

Rank 1 · LXL04_015091 · OH-1004

Cytoplasm0.217

Rank 2 · LXL04_015091 · OH-1004

Cell membrane0.063

Rank 3 · LXL04_015091 · OH-1004

Endoplasmic reticulum0.033

Rank 4 · LXL04_015091 · OH-1004

Plastid0.018

Rank 5 · LXL04_015091 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16796.12Microtub_bd256-378 aa

PF00225.30Kinesin276-573 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015091	`PF16796.12`	Microtub_bd	256	378	4.3e-10	40.4
LXL04_015091	`PF00225.30`	Kinesin	276	573	3.1e-53	181.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HR11`	Arabidopsis thaliana	Kinesin-like protein KIN-6	49.837%	Swiss-Prot	moderate database homology
`Q6YU88`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-6	45.000%	Swiss-Prot	moderate database homology
`Q2R2P7`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-7L	32.143%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card