LXL04_015051 | RubberDandelionOmics

Gene overview

LXL04_015051

Reference: OH-1004 Chr: Chr03 Coordinates: 62633836-62635293 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1458 bp · LXL04_015051|LXL04_015051|OH1004|cDNA

ATGGATTCTCActtctttctctttctctctctactCACACTCTCCGCTACCGTCACCGtcaccgccaccgccaccgccaccgtcAGCACACTCAACGTTGCGTCAGCTGTCCAGAAAACTCTCGACCTCCTAAACCCCACTTTACTCCAAGAACATGTTGAAAAAACCACACCTGAATCTACCTCTTCGTCATTGTCTTTCACCCTCCATCCTCGATCCTCTATCCACCAtacccaccaccaccaccatgaTTACGCATC...

CDS

Download CDS FASTA

1458 bp · LXL04_015051|LXL04_015051|OH1004|CDS

ATGGATTCTCACTTCTTTCTCTTTCTCTCTCTACTCACACTCTCCGCTACCGTCACCGTCACCGCCACCGCCACCGCCACCGTCAGCACACTCAACGTTGCGTCAGCTGTCCAGAAAACTCTCGACCTCCTAAACCCCACTTTACTCCAAGAACATGTTGAAAAAACCACACCTGAATCTACCTCTTCGTCATTGTCTTTCACCCTCCATCCTCGATCCTCTATCCACCATACCCACCACCACCACCATGATTACGCATC...

Protein

Download Protein FASTA

485 aa · LXL04_015051|LXL04_015051|OH1004|PROTEIN

MDSHFFLFLSLLTLSATVTVTATATATVSTLNVASAVQKTLDLLNPTLLQEHVEKTTPESTSSSLSFTLHPRSSIHHTHHHHHDYASLTLSRLARDSHRVTSLTTKLNFALAGTNKSELKPAVETDSMLRPEDLSTPVSSGISQGSGEYFARVGLGTPVQLYYMVIDTGSDINWLQCQPCSDCYQQTDPIFNPSASTSYSTLSCSSQQCSSLEITACRSEVCLYQVSYGDGSFTVGDFVTETVTFGKSGSVPKVAMGCGH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015051`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015051

Location Chr03:62633836-62635293 (-)

Description Similar to ASPG1: Protein ASPARTIC PROTEASE IN GUARD CELL 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g18490`	Aspartic protease involved in drought avoidance through abscisic acid signaling.	Overexpression of the aspartic protease ASPG1 gene confers drought avoidance in Arabidopsis.2012 · DOI: 10.1093/jxb/err433
`At1g01300`	Aspartyl protease.	No verified direct reference in this release
`At3g20015`	Aspartic protease that may be involved in drought avoidance through abscisic acid signaling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015051 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

GO:0070001 aspartic-type peptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G01300

ath:AT3G18490

ath:AT3G20015

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.498

Rank 1 · LXL04_015051 · OH-1004

Cell membrane0.169

Rank 2 · LXL04_015051 · OH-1004

Endoplasmic reticulum0.140

Rank 3 · LXL04_015051 · OH-1004

Cytoplasm0.083

Rank 4 · LXL04_015051 · OH-1004

Lysosome / Vacuole0.077

Rank 5 · LXL04_015051 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00026.29Asp148-481 aa

PF14543.12TAXi_N149-308 aa

PF14541.12TAXi_C332-481 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015051	`PF00026.29`	Asp	148	481	2.9e-18	67.1
LXL04_015051	`PF14543.12`	TAXi_N	149	308	6.2e-48	164.0
LXL04_015051	`PF14541.12`	TAXi_C	332	481	2e-35	122.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LS40`	Arabidopsis thaliana	Protein ASPARTIC PROTEASE IN GUARD CELL 1	56.426%	Swiss-Prot	strong database homology
`Q9LNJ3`	Arabidopsis thaliana	Aspartyl protease family protein 2	55.087%	Swiss-Prot	strong database homology
`Q9LHE3`	Arabidopsis thaliana	Protein ASPARTIC PROTEASE IN GUARD CELL 2	42.484%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card