Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3499 bp · LXL04_015029|LXL04_015029|OH1004|cDNA
TTAAATTACAAGAGAAACCCTCGCAAAAGCAAGAATGGCGGATGAATCACCACCACCAGGAGAGGAATCTCTCCAACCAGCAACACCATTGTTCCCGGTTTTGCCCACAACAGCCTCCGAACCAATAAACCCTCTACAACTCTCTAATTCCAACGCACCAGGCTGGCTCAGCAACACCAGCTTCACAGCCGACATCTCAATCATCAATGACGTCGTATCCAGTCGCCACCATCACTACAGCGAACTCGAtgaagaggaag...
3465 bp · LXL04_015029|LXL04_015029|OH1004|CDS
ATGGCGGATGAATCACCACCACCAGGAGAGGAATCTCTCCAACCAGCAACACCATTGTTCCCGGTTTTGCCCACAACAGCCTCCGAACCAATAAACCCTCTACAACTCTCTAATTCCAACGCACCAGGCTGGCTCAGCAACACCAGCTTCACAGCCGACATCTCAATCATCAATGACGTCGTATCCAGTCGCCACCATCACTACAGCGAACTCGATGAAGAGGAAGAAGAGAAAACAGCAGCAGAAACAGAAGAAAGGCG...
Protein
Download Protein FASTA1154 aa · LXL04_015029|LXL04_015029|OH1004|PROTEIN
MADESPPPGEESLQPATPLFPVLPTTASEPINPLQLSNSNAPGWLSNTSFTADISIINDVVSSRHHHYSELDEEEEEKTAAETEERRPQARYELVDSSASDQDIDRNSRSSNKEQKRKRRKTKKGAANSGYDYGPSSRKQNIKSWAKETTSSSATKEYYFDSRGDRDNLAFGCLYRMDVARYKLFHGSKSSGFNSNFHSSNTRSWGFDGDNDVSSLDTKLRSEGRYWSAKYAALEHHKNFKRLRIIAPKDSTPETTTDFV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_015029 |
|---|---|
| TK1151 ID | TkA02G373300 |
| OH-1004 ID | LXL04_015029 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_015029 |
|---|---|
| Location | Chr03:62165836-62171067 (-) |
| Description | Similar to NRDE2: Nuclear exosome regulator NRDE2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000278 mitotic cell cycle Biological Process GO:0006396 RNA processing Biological Process GO:0006397 mRNA processing Biological Process GO:0006974 DNA damage response Biological Process GO:0008380 RNA splicing Biological Process GO:0031048 regulatory ncRNA-mediated heterochromatin formation Biological Process GO:0046833 positive regulation of RNA export from nucleus Biological Process GO:0048255 mRNA stabilization Biological Process GO:0051301 cell division Biological Process GO:0071030 nuclear mRNA surveillance of spliceosomal pre-mRNA splicing Biological Process GO:1902369 negative regulation of RNA catabolic process Biological Process GO:1902795 siRNA-mediated facultative heterochromatin formation Biological Process |
| KEGG gene cross-reference | ddi:DDB_G0283719 hsa:55051 mmu:217827 spo:2540691 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08424.16NRDE-2288-676 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_015029 | PF08424.16 | NRDE-2 | 288 | 676 | 3e-80 | 270.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.