LXL04_015006 | RubberDandelionOmics

Gene overview

LXL04_015006

Reference: OH-1004 Chr: Chr03 Coordinates: 61338368-61342499 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1851 bp · LXL04_015006|LXL04_015006|OH1004|cDNA

ATGGCTGCCAGTCTAACAACCCTCCAATTTCCCTCTCCATATCTGAAATCCCACCACTCTCATACCGTGAAATTCAAGCTCAAATCTGCTCCGATTGCCAATCCGAATGGGAGCTCACGGAGTTGTGGGATTAAATGCTCGTATTCAAATGGGAGAAAGCCTGATTCGAGTAGCGACGAAAAGAGCGGCAAGAGCTTGGAGGCGCTACGAGAAGAGAAACGGCGGGCGGAGTTATCGGCGCGAATTGCTTCAGGCGAATT...

CDS

Download CDS FASTA

1851 bp · LXL04_015006|LXL04_015006|OH1004|CDS

ATGGCTGCCAGTCTAACAACCCTCCAATTTCCCTCTCCATATCTGAAATCCCACCACTCTCATACCGTGAAATTCAAGCTCAAATCTGCTCCGATTGCCAATCCGAATGGGAGCTCACGGAGTTGTGGGATTAAATGCTCGTATTCAAATGGGAGAAAGCCTGATTCGAGTAGCGACGAAAAGAGCGGCAAGAGCTTGGAGGCGCTACGAGAAGAGAAACGGCGGGCGGAGTTATCGGCGCGAATTGCTTCAGGCGAATT...

Protein

Download Protein FASTA

616 aa · LXL04_015006|LXL04_015006|OH1004|PROTEIN

MAASLTTLQFPSPYLKSHHSHTVKFKLKSAPIANPNGSSRSCGIKCSYSNGRKPDSSSDEKSGKSLEALREEKRRAELSARIASGEFTVEKPSSFGSLLVNSLTKLGVPSEFLESLSQLINLDDKYPKIPEAKGAISAIRSEAFFIPLYELFLTYGGIFRLTFGPKSFLIVSDPIIAKRILKDNAKAYSKGILAEILEFVMGTGLIPADGEVWRVRRRVIVPALHLKYVAAMIGLFGEATDRLCKKLDAAAYNGEDVEME...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015006`
TK1151 ID	TkA02G378150
OH-1004 ID	LXL04_015006
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015006

Location Chr03:61338368-61342499 (-)

Description Similar to CYP97A3: Protein LUTEIN DEFICIENT 5, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31800`	Heme-containing cytochrome P450 involved in the biosynthesis of xanthophylls.	Defining the primary route for lutein synthesis in plants: the role of Arabidopsis carotenoid beta-ring hydroxylase CYP97A3.2006 · DOI: 10.1073/pnas.0511207103 Elucidation of the beta-carotene hydroxylation pathway in Arabidopsis thaliana.2006 · DOI: 10.1016/j.febslet.2006.07.055 The evolution and function of carotenoid hydroxylases in Arabidopsis.2009 · DOI: 10.1093/pcp/pcp005
`At3g53130`	Heme-containing cytochrome P450 involved in the biosynthesis of xanthophylls.	Functional analysis of beta- and epsilon-ring carotenoid hydroxylases in Arabidopsis.2003 · DOI: 10.1105/tpc.011403 Elucidation of the beta-carotene hydroxylation pathway in Arabidopsis thaliana.2006 · DOI: 10.1016/j.febslet.2006.07.055 The evolution and function of carotenoid hydroxylases in Arabidopsis.2009 · DOI: 10.1093/pcp/pcp005 Over-expression of Arabidopsis thaliana carotenoid hydroxylases individually and in combination with a beta-carotene ketolase provides insight into in vivo functions.2010 · DOI: 10.1016/j.phytochem.2009.10.011 A quadruple mutant of Arabidopsis reveals a β-carotene hydroxylation activity for LUT1/CYP97C1 and a regulatory role of xanthophylls on determination of the PSI/PSII ratio.2012 · DOI: 10.1186/1471-2229-12-50
`At4g15110`	Heme-containing cytochrome P450 probably involved in the biosynthesis of xanthophylls.	Over-expression of Arabidopsis thaliana carotenoid hydroxylases individually and in combination with a beta-carotene ketolase provides insight into in vivo functions.2010 · DOI: 10.1016/j.phytochem.2009.10.011

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015006 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016117 carotenoid biosynthetic process Biological Process

GO:0016123 xanthophyll biosynthetic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0010291 beta-carotene 3-hydroxylase activity Molecular Function

GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function

GO:0020037 heme binding Molecular Function

KEGG gene cross-reference

ath:AT1G31800

ath:AT3G53130

ath:AT4G15110

gmx:606504

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.982

Rank 1 · LXL04_015006 · OH-1004

Mitochondrion0.023

Rank 2 · LXL04_015006 · OH-1004

Cytoplasm0.015

Rank 3 · LXL04_015006 · OH-1004

Peroxisome0.013

Rank 4 · LXL04_015006 · OH-1004

Cell membrane0.012

Rank 5 · LXL04_015006 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067.28p450148-569 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015006	`PF00067.28`	p450	148	569	5.8e-87	293.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93VK5`	Arabidopsis thaliana	Protein LUTEIN DEFICIENT 5, chloroplastic	80.183%	Swiss-Prot	strong database homology
`Q6TBX7`	Arabidopsis thaliana	Carotene epsilon-monooxygenase, chloroplastic	53.363%	Swiss-Prot	strong database homology
`O23365`	Arabidopsis thaliana	Cytochrome P450 97B3, chloroplastic	43.636%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card