LXL04_015002 | RubberDandelionOmics

Gene overview

LXL04_015002

Reference: OH-1004 Chr: Chr03 Coordinates: 61303534-61306711 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2130 bp · LXL04_015002|LXL04_015002|OH1004|cDNA

ATGAATTGTTTGCCATGCCTTAGAAAGAAGAAACCCGATGGAAAGAAGAAAACCGATGGAAAGAAAGAAGATAAGAAGGAAGATAAGAAGGAAGATGGGGAGTTGCCTGTGGCACAACCTAAAGTCAATCCCCTATCAAAACAACCTACCCTATCAAAAGTACCTACTGTGAAAATCACCGGTTCAAACAAAAAATATGATTCATACAAACAAAACAATCTAAGCAAACAAGACAATTTAAACAAACAAGAGCAAATTGT...

CDS

Download CDS FASTA

2130 bp · LXL04_015002|LXL04_015002|OH1004|CDS

ATGAATTGTTTGCCATGCCTTAGAAAGAAGAAACCCGATGGAAAGAAGAAAACCGATGGAAAGAAAGAAGATAAGAAGGAAGATAAGAAGGAAGATGGGGAGTTGCCTGTGGCACAACCTAAAGTCAATCCCCTATCAAAACAACCTACCCTATCAAAAGTACCTACTGTGAAAATCACCGGTTCAAACAAAAAATATGATTCATACAAACAAAACAATCTAAGCAAACAAGACAATTTAAACAAACAAGAGCAAATTGT...

Protein

Download Protein FASTA

709 aa · LXL04_015002|LXL04_015002|OH1004|PROTEIN

MNCLPCLRKKKPDGKKKTDGKKEDKKEDKKEDGELPVAQPKVNPLSKQPTLSKVPTVKITGSNKKYDSYKQNNLSKQDNLNKQEQIVDIDDGVVGSTTVAVPVVTPTPYQPPEDPTGTYRFHELTAATKNFNKECLLGESAFGKVYKGTLPDGKIVAVKQLDKNGFKANKEFLEEAGKLSEFQHPNLVDLIGYCAEGDQRVLVYEYMPNGSLKDNLFGYTPSDWITRMKAASGAAQAIQYLHEKVNPPVLCRNLKCTNIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015002`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015002

Location Chr03:61303534-61306711 (+)

Description Similar to PBL26: Probable serine/threonine-protein kinase PBL26

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16500`	Involved in pollen tube guidance into micropyle.	No verified direct reference in this release
`At3g07070`	May be involved in plant defense signaling.	No verified direct reference in this release
`At4g13190`	May be involved in plant defense signaling.	No verified direct reference in this release
`At5g02800`	Serine/threonine-protein kinase involved in the positive regulation of brassinosteroid (BR) signaling and plant growth.	No verified direct reference in this release
`At3g02810`	Involved in pollen tube guidance into micropyle.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015002 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:1900459 positive regulation of brassinosteroid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT3G02810

ath:AT3G07070

ath:AT4G13190

ath:AT5G02800

ath:AT5G16500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.600

Rank 1 · LXL04_015002 · OH-1004

Cytoplasm0.289

Rank 2 · LXL04_015002 · OH-1004

Nucleus0.185

Rank 3 · LXL04_015002 · OH-1004

Endoplasmic reticulum0.052

Rank 4 · LXL04_015002 · OH-1004

Golgi apparatus0.041

Rank 5 · LXL04_015002 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase132-395 aa

PF07714.24PK_Tyr_Ser-Thr135-396 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015002	`PF00069.32`	Pkinase	132	395	7.2e-35	121.4
LXL04_015002	`PF07714.24`	PK_Tyr_Ser-Thr	135	396	2.6e-37	129.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1PDW3`	Arabidopsis thaliana	Receptor-like kinase LIP1	57.980%	Swiss-Prot	weak database homology
`Q9SFT7`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL26	59.794%	Swiss-Prot	weak database homology
`Q1PE89`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL24	56.849%	Swiss-Prot	weak database homology
`Q0WRY5`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL7	54.232%	Swiss-Prot	weak database homology
`Q9M8S2`	Arabidopsis thaliana	Receptor-like kinase LIP2	44.989%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card