LXL04_014931 | RubberDandelionOmics

Gene overview

LXL04_014931

Reference: OH-1004 Chr: Chr03 Coordinates: 59830886-59831233 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

348 bp · LXL04_014931|LXL04_014931|OH1004|cDNA

ATGTCGAAAGAAGTAAGTGAAGCCGGAGAAACGGCGAGGATGGACTATGTTGACCCACCGCCAGCACCCCTCCTTGACATGGAGGAGCTTAAGCTCTGGTCGTTTTACAGAGCCTTAATTGCTGAATTTGTCGCCACCCTCCTCTTCCTGTACGTCACCGTCGCCACCGTCATCGGCTACAAAAAAGAAACCGACCCATGCGGCGGCGGCGGCCTTCTCGGAATCGCGTGGGCATTCGGTGGCATGATCTTCATCCTCGT...

CDS

Download CDS FASTA

348 bp · LXL04_014931|LXL04_014931|OH1004|CDS

ATGTCGAAAGAAGTAAGTGAAGCCGGAGAAACGGCGAGGATGGACTATGTTGACCCACCGCCAGCACCCCTCCTTGACATGGAGGAGCTTAAGCTCTGGTCGTTTTACAGAGCCTTAATTGCTGAATTTGTCGCCACCCTCCTCTTCCTGTACGTCACCGTCGCCACCGTCATCGGCTACAAAAAAGAAACCGACCCATGCGGCGGCGGCGGCCTTCTCGGAATCGCGTGGGCATTCGGTGGCATGATCTTCATCCTCGT...

Protein

Download Protein FASTA

115 aa · LXL04_014931|LXL04_014931|OH1004|PROTEIN

MSKEVSEAGETARMDYVDPPPAPLLDMEELKLWSFYRALIAEFVATLLFLYVTVATVIGYKKETDPCGGGGLLGIAWAFGGMIFILVYCTAGISGKLRFPIPTLHRQNPNHTELN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014931`
TK1151 ID	TkA05G473380
OH-1004 ID	LXL04_014931
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.400
Protein coverage (%)	TK1151 76.667 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014931

Location Chr03:59830886-59831233 (-)

Description Similar to PIP2-8: Probable aquaporin PIP2-8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g16850`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release
`At4g35100`	Water channel required to facilitate the transport of water across cell membrane.	Characterization of two new channel protein genes in Arabidopsis.1999 · DOI: 10.1016/s1016-8478(23)13513-8

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0233400`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014931 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:1902074 response to salt Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0015250 water channel activity Molecular Function

KEGG gene cross-reference

ath:AT2G16850

ath:AT4G35100

dosa:Os04g0233400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.542

Rank 1 · LXL04_014931 · OH-1004

Cell membrane0.248

Rank 2 · LXL04_014931 · OH-1004

Cytoplasm0.117

Rank 3 · LXL04_014931 · OH-1004

Lysosome / Vacuole0.087

Rank 4 · LXL04_014931 · OH-1004

Golgi apparatus0.086

Rank 5 · LXL04_014931 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00230.26MIP29-95 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014931	`PF00230.26`	MIP	29	95	6.9e-17	62.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVX8`	Arabidopsis thaliana	Probable aquaporin PIP2-8	84.211%	Swiss-Prot	strong database homology
`P93004`	Arabidopsis thaliana	Aquaporin PIP2-7	84.375%	Swiss-Prot	strong database homology
`Q7XLR1`	Oryza sativa subsp. japonica	Probable aquaporin PIP2-6	78.571%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card