LXL04_014923 | RubberDandelionOmics

Gene overview

LXL04_014923

Reference: OH-1004 Chr: Chr03 Coordinates: 59688744-59689720 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

705 bp · LXL04_014923|LXL04_014923|OH1004|cDNA

ATGGCGACTCGACTCTGTAAGGGGATAGCCGTCGCATCTTCTTCATCGACGCTCTCTGTTCCCAAACAAATACTAGACGAAGCCTCGCCTGTGATCGCCATCATTTTCCCTAGCTTGTCTAAGGTTAGATGGGCTTCGTCTTCGTCGGAGGGCGCGGGTGAGACCCCTGTGAAGCCCAAAAAGAAGATGCAGGACCGTCTTTCCGGTGTTATAGACGCTGTTAATGACCGGAAGCTCCCTCCTGAACTCCGTGGCCAGCG...

CDS

Download CDS FASTA

705 bp · LXL04_014923|LXL04_014923|OH1004|CDS

ATGGCGACTCGACTCTGTAAGGGGATAGCCGTCGCATCTTCTTCATCGACGCTCTCTGTTCCCAAACAAATACTAGACGAAGCCTCGCCTGTGATCGCCATCATTTTCCCTAGCTTGTCTAAGGTTAGATGGGCTTCGTCTTCGTCGGAGGGCGCGGGTGAGACCCCTGTGAAGCCCAAAAAGAAGATGCAGGACCGTCTTTCCGGTGTTATAGACGCTGTTAATGACCGGAAGCTCCCTCCTGAACTCCGTGGCCAGCG...

Protein

Download Protein FASTA

234 aa · LXL04_014923|LXL04_014923|OH1004|PROTEIN

MATRLCKGIAVASSSSTLSVPKQILDEASPVIAIIFPSLSKVRWASSSSEGAGETPVKPKKKMQDRLSGVIDAVNDRKLPPELRGQRNNIRSETDIINVVEQRIWHSMEEGQFENLPGKGKPLNLNSNPHADPAEDTLYRILSRNKCAPEWVELNKEIRNSVAEWRLSLKKSWNRKESGDSSKWSENSDSLKLQLRSINDKVFRYNLIVPFGRQMNGLKWEKEVTRLNEVQPTT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014923`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_014923`
Location	Chr03:59688744-59689720 (+)
Description	Similar to Dnajc28: DnaJ homolog subfamily C member 28
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014923` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0001659 temperature homeostasis Biological Process
KEGG gene cross-reference	hsa:54943 mmu:246738 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.753

Rank 1 · LXL04_014923 · OH-1004

Plastid0.193

Rank 2 · LXL04_014923 · OH-1004

Nucleus0.066

Rank 3 · LXL04_014923 · OH-1004

Cytoplasm0.064

Rank 4 · LXL04_014923 · OH-1004

Cell membrane0.016

Rank 5 · LXL04_014923 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09350.16DJC28_CD99-165 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014923	`PF09350.16`	DJC28_CD	99	165	1e-22	80.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card