LXL04_014922 | RubberDandelionOmics

Gene overview

LXL04_014922

Reference: OH-1004 Chr: Chr03 Coordinates: 59683116-59686356 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1314 bp · LXL04_014922|LXL04_014922|OH1004|cDNA

ATGAAGATGGTCTCCATGAAAAAGCTTTGTGTTCTTCCTTTTCTATGTGCGTTAGGTTGCATTTCTTCTGTTACATCAATCGGGAACAGTTCTGGTGGAACCATTGATGGCTCTGAAACATGGGGATACGTTGAAGTTCGCCCACGTGCACATATGTTTTGGTGGTTGTATAAGAGTCCTAATAAACCCAAACATCCAACGAAACCATGGCCTACGATTCTATGGCTCCAAGGAGGCCCGGGTGGTTCCGGAGTTGGCTT...

CDS

Download CDS FASTA

1314 bp · LXL04_014922|LXL04_014922|OH1004|CDS

ATGAAGATGGTCTCCATGAAAAAGCTTTGTGTTCTTCCTTTTCTATGTGCGTTAGGTTGCATTTCTTCTGTTACATCAATCGGGAACAGTTCTGGTGGAACCATTGATGGCTCTGAAACATGGGGATACGTTGAAGTTCGCCCACGTGCACATATGTTTTGGTGGTTGTATAAGAGTCCTAATAAACCCAAACATCCAACGAAACCATGGCCTACGATTCTATGGCTCCAAGGAGGCCCGGGTGGTTCCGGAGTTGGCTT...

Protein

Download Protein FASTA

437 aa · LXL04_014922|LXL04_014922|OH1004|PROTEIN

MKMVSMKKLCVLPFLCALGCISSVTSIGNSSGGTIDGSETWGYVEVRPRAHMFWWLYKSPNKPKHPTKPWPTILWLQGGPGGSGVGFGNFGELGPVDVDLKPRNSTWLQKADLLFVDSPVGTGYSYVEDESLFVKTDVEAAIDVTTLLKAIYNGNNTMSPLYIFAESYGGKFAVTLALAALQAIEKQELKLQLGGVALGDSWISPEDFVLSWGPLLKDVSRIDDVGLNKSNSLALNIQQQIADGQYEKATNSWSYLEEVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014922`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014922

Location Chr03:59683116-59686356 (+)

Description Similar to SCPL51: Serine carboxypeptidase-like 51

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27920`	Probable carboxypeptidase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014922 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0042573 retinoic acid metabolic process Biological Process

GO:0045776 negative regulation of blood pressure Biological Process

GO:0097746 blood vessel diameter maintenance Biological Process

GO:0005576 extracellular region Cellular Component

GO:0048471 perinuclear region of cytoplasm Cellular Component

GO:0070062 extracellular exosome Cellular Component

GO:0004185 serine-type carboxypeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT2G27920

ddi:DDB_G0291912

hsa:59342

mmu:74617

rno:114861

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.521

Rank 1 · LXL04_014922 · OH-1004

Extracellular0.200

Rank 2 · LXL04_014922 · OH-1004

Cytoplasm0.101

Rank 3 · LXL04_014922 · OH-1004

Endoplasmic reticulum0.087

Rank 4 · LXL04_014922 · OH-1004

Golgi apparatus0.080

Rank 5 · LXL04_014922 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00450.29Peptidase_S1035-432 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014922	`PF00450.29`	Peptidase_S10	35	432	5.8e-72	244.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q67Y83`	Arabidopsis thaliana	Serine carboxypeptidase-like 51	56.629%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card