LXL04_014920 | RubberDandelionOmics

Gene overview

LXL04_014920

Reference: OH-1004 Chr: Chr03 Coordinates: 59623265-59624968 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1704 bp · LXL04_014920|LXL04_014920|OH1004|cDNA

ATGATTTCCAGCTCTCCGAGCTTCCATCTCCATCATCGTCCCCACCCCCATGATCGTATTCATCGTCATGCTCTCTCAAAACAAAGCCTCAATTCCATTCCCTTTTCCCTTCACCTTTCCAATGTATCCATTACAATTCCAATCATCAAATCGCCACTTCTCATCCACAGAAAACCCACCATCTTCAGACCCATGTCATCCACTCTACCCAATTCCATTCCGGACTTCCAACCCGACCCAACTCTCATCAACGACGACCT...

CDS

Download CDS FASTA

1704 bp · LXL04_014920|LXL04_014920|OH1004|CDS

ATGATTTCCAGCTCTCCGAGCTTCCATCTCCATCATCGTCCCCACCCCCATGATCGTATTCATCGTCATGCTCTCTCAAAACAAAGCCTCAATTCCATTCCCTTTTCCCTTCACCTTTCCAATGTATCCATTACAATTCCAATCATCAAATCGCCACTTCTCATCCACAGAAAACCCACCATCTTCAGACCCATGTCATCCACTCTACCCAATTCCATTCCGGACTTCCAACCCGACCCAACTCTCATCAACGACGACCT...

Protein

Download Protein FASTA

567 aa · LXL04_014920|LXL04_014920|OH1004|PROTEIN

MISSSPSFHLHHRPHPHDRIHRHALSKQSLNSIPFSLHLSNVSITIPIIKSPLLIHRKPTIFRPMSSTLPNSIPDFQPDPTLINDDLAPTPASQRTFSGWEMASLWVGLVVGVPTYYLAGSLVDLGMSWWQGILTVVTANIITFVTLGLTGHPGTRYGIPFPVLARSAFGIHGAHIPTLLRGLVACGWYGIETWIGGEAIFLLLPNSIKKSSFSNAIPWLGTSPIEFACFLVFWLAQLVVVIKGMDGIRQLEKYSAPILI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014920`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014920

Location Chr03:59623265-59624968 (-)

Description Similar to NCS1: Purine-uracil permease NCS1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03555`	Nucleobase-proton symporter that facilitates the uptake of nucleobases in the cells.	De novo pyrimidine nucleotide synthesis mainly occurs outside of plastids, but a previously undiscovered nucleobase importer provides substrates for the essential salvage pathway in Arabidopsis.2012 · DOI: 10.1105/tpc.112.096743 Genetic and molecular characterization reveals a unique nucleobase cation symporter 1 in Arabidopsis.2012 · DOI: 10.1016/j.febslet.2012.03.058 Structure-function relationship of a plant NCS1 member--homology modeling and mutagenesis identified residues critical for substrate specificity of PLUTO, a nucleobase transporter from Arabidopsis.2014 · DOI: 10.1371/journal.pone.0091343

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014920 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000256 allantoin catabolic process Biological Process

GO:0006144 purine nucleobase metabolic process Biological Process

GO:0015720 allantoin transport Biological Process

GO:0015851 nucleobase transport Biological Process

GO:0043100 pyrimidine nucleobase salvage Biological Process

GO:0098721 uracil import across plasma membrane Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT5G03555

bsu:BSU36470

sce:YIR028W

spo:2541559

spo:2542586

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.964

Rank 1 · LXL04_014920 · OH-1004

Mitochondrion0.028

Rank 2 · LXL04_014920 · OH-1004

Peroxisome0.021

Rank 3 · LXL04_014920 · OH-1004

Cell membrane0.021

Rank 4 · LXL04_014920 · OH-1004

Endoplasmic reticulum0.020

Rank 5 · LXL04_014920 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02133.22Transp_cyt_pur89-534 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014920	`PF02133.22`	Transp_cyt_pur	89	534	2.9e-103	346.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZD0`	Arabidopsis thaliana	Purine-uracil permease NCS1	63.380%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card