LXL04_014906 | RubberDandelionOmics

Gene overview

LXL04_014906

Reference: OH-1004 Chr: Chr03 Coordinates: 59381507-59382169 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

663 bp · LXL04_014906|LXL04_014906|OH1004|cDNA

ATGGCGGAGCAGCATCGATCAAGTACCAAGCCACCTCACGTTCTTGTTTTTCCCTTCCCATTGCAAGGCCACATTAAACCCATCATTCAGTTCGACAAACGTTTATTATCCAAAGGCGTCAAAAGACTCAAAACAACCCTCGTGACCACAATTTACATCTCAAACAAAATCCCCTCCCACTCCCAGAACACCTCCATACCAATCGAACCCATTTCCGATGGATTCGACTCCGGCGGCCACCAGAGCGCTGACAACTTTGA...

CDS

Download CDS FASTA

663 bp · LXL04_014906|LXL04_014906|OH1004|CDS

ATGGCGGAGCAGCATCGATCAAGTACCAAGCCACCTCACGTTCTTGTTTTTCCCTTCCCATTGCAAGGCCACATTAAACCCATCATTCAGTTCGACAAACGTTTATTATCCAAAGGCGTCAAAAGACTCAAAACAACCCTCGTGACCACAATTTACATCTCAAACAAAATCCCCTCCCACTCCCAGAACACCTCCATACCAATCGAACCCATTTCCGATGGATTCGACTCCGGCGGCCACCAGAGCGCTGACAACTTTGA...

Protein

Download Protein FASTA

220 aa · LXL04_014906|LXL04_014906|OH1004|PROTEIN

MAEQHRSSTKPPHVLVFPFPLQGHIKPIIQFDKRLLSKGVKRLKTTLVTTIYISNKIPSHSQNTSIPIEPISDGFDSGGHQSADNFESYVNKFRQVGSKSLADLIRKLDNEGNPIDAIVYDFFLTWALDVEMEFGINDSCFFTQACTVNNIYYHVHKGLLSIPPAANPGSHPGWALGLFNQFSNIHHSIGYGGRTQARSQILMARRLKGRRWSMILGCRG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014906`
TK1151 ID	TkA02G292510
OH-1004 ID	LXL04_014906
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	82.500
Protein coverage (%)	TK1151 93.119 / OH-1004 85.455 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014906

Location Chr03:59381507-59382169 (-)

Description Similar to UGT74G1: UDP-glycosyltransferase 74G1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g43820`	Glycosyltransferase that glucosylates benzoic acid and derivatives.	Glucose conjugation of anthranilate by the Arabidopsis UGT74F2 glucosyltransferase is required for tryptophan mutant blue fluorescence.2003 · DOI: 10.1074/jbc.m211822200
`At2g43840`	Possesses quercetin 7-O-glucosyltransferase and 4'-O- glucosyltransferase activities in vitro.	Glucose conjugation of anthranilate by the Arabidopsis UGT74F2 glucosyltransferase is required for tryptophan mutant blue fluorescence.2003 · DOI: 10.1074/jbc.m211822200
`At1g05675`	UDP-glycosyltransferase 74E1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014906 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009696 salicylic acid metabolic process Biological Process

GO:0010030 positive regulation of seed germination Biological Process

GO:0018874 benzoate metabolic process Biological Process

GO:0032787 monocarboxylic acid metabolic process Biological Process

GO:0046482 para-aminobenzoic acid metabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0033836 flavonol 7-O-beta-glucosyltransferase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0052639 salicylic acid glucosyltransferase (ester-forming) activity Molecular Function

GO:0052640 salicylic acid glucosyltransferase (glucoside-forming) activity Molecular Function

KEGG gene cross-reference

ag:AEM42999

ath:AT1G05675

ath:AT2G43820

ath:AT2G43840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.735

Rank 1 · LXL04_014906 · OH-1004

Nucleus0.278

Rank 2 · LXL04_014906 · OH-1004

Endoplasmic reticulum0.078

Rank 3 · LXL04_014906 · OH-1004

Plastid0.060

Rank 4 · LXL04_014906 · OH-1004

Peroxisome0.047

Rank 5 · LXL04_014906 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22822`	Arabidopsis thaliana	UDP-glycosyltransferase 74F2	42.188%	Swiss-Prot	moderate database homology
`O22820`	Arabidopsis thaliana	Flavonol 7-O-beta-glucosyltransferase UGT74F1	44.444%	Swiss-Prot	moderate database homology
`P0C7P7`	Arabidopsis thaliana	UDP-glycosyltransferase 74E1	40.523%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card