LXL04_014883 | RubberDandelionOmics

Gene overview

LXL04_014883

Reference: OH-1004 Chr: Chr03 Coordinates: 58866571-58873218 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1608 bp · LXL04_014883|LXL04_014883|OH1004|cDNA

ATGTTGAGGCTTTCTACATTCAAAAATGTACTGGAATCGTTTATAGCTGGTGGAGATGACATCATTGTGTATATTATGGAGATCTGGACCCAATTCAGAGGGCCAGTTGTGGCGCCATTGCTGAGAATTCTGATGTATATTTCTCTGGCAATGTCAATAATGTTGTTCATAGAAAAGGTTTATATGTCTTTGGTGGTTGGACATAATTATTTATTTGGGAGAAAGACAGAAAAACGTTACAAATGGGTAGAATTTAAAAA...

CDS

Download CDS FASTA

1608 bp · LXL04_014883|LXL04_014883|OH1004|CDS

ATGTTGAGGCTTTCTACATTCAAAAATGTACTGGAATCGTTTATAGCTGGTGGAGATGACATCATTGTGTATATTATGGAGATCTGGACCCAATTCAGAGGGCCAGTTGTGGCGCCATTGCTGAGAATTCTGATGTATATTTCTCTGGCAATGTCAATAATGTTGTTCATAGAAAAGGTTTATATGTCTTTGGTGGTTGGACATAATTATTTATTTGGGAGAAAGACAGAAAAACGTTACAAATGGGTAGAATTTAAAAA...

Protein

Download Protein FASTA

535 aa · LXL04_014883|LXL04_014883|OH1004|PROTEIN

MLRLSTFKNVLESFIAGGDDIIVYIMEIWTQFRGPVVAPLLRILMYISLAMSIMLFIEKVYMSLVVGHNYLFGRKTEKRYKWVEFKNDVELGNSIYPLVLIQIPMFNEREVYQLSIGAACGLSWPTDRIVIQVLDDSTDPIIKDMVEMECQKWASKGTNIHYQVRDNRKGYKAGALKEGLKHQYANECEYVAIFDADFQPESDFLRKTIPFLHHNSQLGLVQARWKFVNSDECLMTRMQEMSLNYHFKVEQEFGSSSHAF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014883`
TK1151 ID	TkA02G388590
OH-1004 ID	LXL04_014883
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014883

Location Chr03:58866571-58873218 (+)

Description Similar to CSLA9: Glucomannan 4-beta-mannosyltransferase 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03760`	Possesses glucomannan synthase and mannan synthase activities in vitro.	Agrobacterium-mediated root transformation is inhibited by mutation of an Arabidopsis cellulose synthase-like gene.2003 · DOI: 10.1104/pp.103.030726
`At5g22740`	Possesses glucomannan synthase and mannan synthase activities in vitro.	No verified direct reference in this release
`At1g23480`	Probable mannan synthase which consists of a 4-beta-mannosyltransferase activity on mannan using GDP-mannose.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0625700`	Probable mannan synthase which consists of a 4-beta-mannosyltransferase activity on mannan using GDP-mannose.	No verified direct reference in this release
`Os02g0192500`	Possesses glucomannan synthase and mannan synthase activities in vitro.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014883 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009294 DNA-mediated transformation Biological Process

GO:0009617 response to bacterium Biological Process

GO:0010192 mucilage biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0047259 glucomannan 4-beta-mannosyltransferase activity Molecular Function

GO:0051753 mannan synthase activity Molecular Function

KEGG gene cross-reference

ath:AT1G23480

ath:AT5G03760

ath:AT5G22740

dosa:Os02g0192500

dosa:Os06g0625700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.405

Rank 1 · LXL04_014883 · OH-1004

Golgi apparatus0.297

Rank 2 · LXL04_014883 · OH-1004

Cell membrane0.167

Rank 3 · LXL04_014883 · OH-1004

Cytoplasm0.134

Rank 4 · LXL04_014883 · OH-1004

Nucleus0.083

Rank 5 · LXL04_014883 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13641.13Glyco_tranf_2_399-332 aa

PF00535.33Glycos_transf_2103-262 aa

PF13632.13Glyco_trans_2_3190-401 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014883	`PF13641.13`	Glyco_tranf_2_3	99	332	5.5e-13	49.9
LXL04_014883	`PF00535.33`	Glycos_transf_2	103	262	5.9e-10	40.0
LXL04_014883	`PF13632.13`	Glyco_trans_2_3	190	401	9.4e-18	65.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZR3`	Arabidopsis thaliana	Glucomannan 4-beta-mannosyltransferase 9	69.790%	Swiss-Prot	strong database homology
`Q9FNI7`	Arabidopsis thaliana	Glucomannan 4-beta-mannosyltransferase 2	67.717%	Swiss-Prot	strong database homology
`Q9LQC9`	Arabidopsis thaliana	Probable glucomannan 4-beta-mannosyltransferase 3	64.410%	Swiss-Prot	strong database homology
`Q67VS7`	Oryza sativa subsp. japonica	Probable glucomannan 4-beta-mannosyltransferase 9	65.275%	Swiss-Prot	strong database homology
`Q7PC76`	Oryza sativa subsp. japonica	Glucomannan 4-beta-mannosyltransferase 1	65.882%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card