LXL04_014840 | RubberDandelionOmics

Gene overview

LXL04_014840

Reference: OH-1004 Chr: Chr03 Coordinates: 57877655-57878267 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

468 bp · LXL04_014840|LXL04_014840|OH1004|cDNA

ATGGCAGACAGAAGAATGCCTAAGGTGAAGACAAACCGTGTTAAATACCCAGAGGGATGGGAGCTCATCGAACCTACCCTTCGTGAATTACAAGGAAAAATGAGAGAAGCTGAAAATGATCCACACGATGGGAAGAGAAAATGTGAAGCACTGTGGCCAATTTTCAAAATTGCACACCAAAAGAGTCGATACATCTTTGACCTTTACCATCGAAGGAGAGAAATTTCAAAGGAACTGTTTGAATTTTGCTTGGATCAAGG...

CDS

Download CDS FASTA

468 bp · LXL04_014840|LXL04_014840|OH1004|CDS

ATGGCAGACAGAAGAATGCCTAAGGTGAAGACAAACCGTGTTAAATACCCAGAGGGATGGGAGCTCATCGAACCTACCCTTCGTGAATTACAAGGAAAAATGAGAGAAGCTGAAAATGATCCACACGATGGGAAGAGAAAATGTGAAGCACTGTGGCCAATTTTCAAAATTGCACACCAAAAGAGTCGATACATCTTTGACCTTTACCATCGAAGGAGAGAAATTTCAAAGGAACTGTTTGAATTTTGCTTGGATCAAGG...

Protein

Download Protein FASTA

155 aa · LXL04_014840|LXL04_014840|OH1004|PROTEIN

MADRRMPKVKTNRVKYPEGWELIEPTLRELQGKMREAENDPHDGKRKCEALWPIFKIAHQKSRYIFDLYHRRREISKELFEFCLDQGYADRNIIAKWKKASLLFPGYERLCCLRCIQPRDHNFQTTCVCRVPKHLREEKVIECVHCGCKGCASGD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014840`
TK1151 ID	TkA02G392700
OH-1004 ID	LXL04_014840
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.000
Protein coverage (%)	TK1151 100.000 / OH-1004 96.774 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014840

Location Chr03:57877655-57878267 (+)

Description Similar to Os05g0446300: Protein BUD31 homolog 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0446300`	Protein BUD31 homolog 2.	No verified direct reference in this release
`UniProt: Q94DE2`	Protein BUD31 homolog 1.	No verified direct reference in this release
`Os12g0149800`	Protein BUD31 homolog 3.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014840 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005681 spliceosomal complex Cellular Component

GO:0071006 U2-type catalytic step 1 spliceosome Cellular Component

GO:0071007 U2-type catalytic step 2 spliceosome Cellular Component

GO:0071014 post-mRNA release spliceosomal complex Cellular Component

GO:0071020 post-spliceosomal complex Cellular Component

GO:0003713 transcription coactivator activity Molecular Function

GO:0016922 nuclear receptor binding Molecular Function

KEGG gene cross-reference

bbel:109464260

dosa:Os01g0857700

dosa:Os04g0646100

dosa:Os05g0446300

dosa:Os12g0149800

osa:4337198

rno:89819

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.499

Rank 1 · LXL04_014840 · OH-1004

Cytoplasm0.453

Rank 2 · LXL04_014840 · OH-1004

Mitochondrion0.061

Rank 3 · LXL04_014840 · OH-1004

Cell membrane0.052

Rank 4 · LXL04_014840 · OH-1004

Endoplasmic reticulum0.046

Rank 5 · LXL04_014840 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01125.23BUD316-153 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014840	`PF01125.23`	BUD31	6	153	7.5e-62	208.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q65WT0`	Oryza sativa subsp. japonica	Protein BUD31 homolog 2	85.333%	Swiss-Prot	strong database homology
`Q94DE2`	Oryza sativa subsp. japonica	Protein BUD31 homolog 1	84.667%	Swiss-Prot	strong database homology
`P35682`	Oryza sativa subsp. japonica	Protein BUD31 homolog 3	81.333%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card