LXL04_014698 | RubberDandelionOmics

Gene overview

LXL04_014698

Reference: OH-1004 Chr: Chr03 Coordinates: 55085231-55086448 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

270 bp · LXL04_014698|LXL04_014698|OH1004|cDNA

ATGGATCTGGGTTCACAAAGCAAAAGAGATTCGACGCAGACCCACCTGATTCTTTGCTTTCAGCTTCAGCTAACGATACTACCAACAATATGCTCAgcttctcttcttcttcttcttcctccgccATTAAAGACGGAAACCACAGCTCGCTGCTTCGCATCTTCCGTTTCTGATCTGGACGTGGTGAAGGATATGTCTGGTGGAGGAAAGGGTGTTTCATCAGCTCAGGCTTTGTCAAATGCCATTACGAATCTAGCAGt...

CDS

Download CDS FASTA

270 bp · LXL04_014698|LXL04_014698|OH1004|CDS

ATGGATCTGGGTTCACAAAGCAAAAGAGATTCGACGCAGACCCACCTGATTCTTTGCTTTCAGCTTCAGCTAACGATACTACCAACAATATGCTCAGCTTCTCTTCTTCTTCTTCTTCCTCCGCCATTAAAGACGGAAACCACAGCTCGCTGCTTCGCATCTTCCGTTTCTGATCTGGACGTGGTGAAGGATATGTCTGGTGGAGGAAAGGGTGTTTCATCAGCTCAGGCTTTGTCAAATGCCATTACGAATCTAGCAGT...

Protein

Download Protein FASTA

89 aa · LXL04_014698|LXL04_014698|OH1004|PROTEIN

MDLGSQSKRDSTQTHLILCFQLQLTILPTICSASLLLLLPPPLKTETTARCFASSVSDLDVVKDMSGGGKGVSSAQALSNAITNLAVLI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014698`
TK1151 ID	TkA04G222450
OH-1004 ID	LXL04_014698
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	81.500
Protein coverage (%)	TK1151 22.500 / OH-1004 30.337 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014698

Location Chr03:55085231-55086448 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g52240`	Guanine-nucleotide exchange factor (GEF) that acts as an activator of Rop (Rho of plants) GTPases by promoting the exchange of GDP for GTP.	A small GTPase activator protein interacts with cytoplasmic phytochromes in regulating root development.2010 · DOI: 10.1074/jbc.m110.133710
`At3g24620`	Guanine-nucleotide exchange factor (GEF) that acts as an activator of Rop (Rho of plants) GTPases by promoting the exchange of GDP for GTP.	Structural evidence for a common intermediate in small G protein-GEF reactions.2007 · DOI: 10.1016/j.molcel.2006.11.023
`At4g13240`	Guanine-nucleotide exchange factor (GEF) that acts as an activator of Rop (Rho of plants) GTPases by promoting the exchange of GDP for GTP.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014698 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0048364 root development Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:0080147 root hair cell development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005085 guanyl-nucleotide exchange factor activity Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT1G52240

ath:AT3G24620

ath:AT4G13240

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.407

Rank 1 · LXL04_014698 · OH-1004

Cytoplasm0.325

Rank 2 · LXL04_014698 · OH-1004

Cell membrane0.151

Rank 3 · LXL04_014698 · OH-1004

Endoplasmic reticulum0.122

Rank 4 · LXL04_014698 · OH-1004

Mitochondrion0.118

Rank 5 · LXL04_014698 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03759.19PRONE59-87 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014698	`PF03759.19`	PRONE	59	87	1.8e-07	31.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M811`	Arabidopsis thaliana	Rop guanine nucleotide exchange factor 11	80.000%	Swiss-Prot	weak database homology
`Q9LV40`	Arabidopsis thaliana	Rho guanine nucleotide exchange factor 8	85.185%	Swiss-Prot	weak database homology
`Q9SVQ3`	Arabidopsis thaliana	Rop guanine nucleotide exchange factor 9	54.348%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card