LXL04_014627 | RubberDandelionOmics

Gene overview

LXL04_014627

Reference: OH-1004 Chr: Chr03 Coordinates: 54154698-54155927 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

420 bp · LXL04_014627|LXL04_014627|OH1004|cDNA

ATGATGAAAGGTTTATTCAGAGGCCTGCGTTGCATGTTTGACACAGATGATGAAAAAGAGCCCGAAATTCAGATTGGTAATCCAACTGATGTTAAACATGTCGCGCATATTGGATGTGATGGCCCTTCTACCCCGGCGCCTAGTTGGATGAACGAGTATCAAGGCGATTCTCAATCTGGTGACAAAAAAGCTGGACCAAAAGATCTTGGTGCGGCTGCTGCTTCCCCTAGCCGCCACGGAAAACAATCCAAAACCAGAAA...

CDS

Download CDS FASTA

420 bp · LXL04_014627|LXL04_014627|OH1004|CDS

ATGATGAAAGGTTTATTCAGAGGCCTGCGTTGCATGTTTGACACAGATGATGAAAAAGAGCCCGAAATTCAGATTGGTAATCCAACTGATGTTAAACATGTCGCGCATATTGGATGTGATGGCCCTTCTACCCCGGCGCCTAGTTGGATGAACGAGTATCAAGGCGATTCTCAATCTGGTGACAAAAAAGCTGGACCAAAAGATCTTGGTGCGGCTGCTGCTTCCCCTAGCCGCCACGGAAAACAATCCAAAACCAGAAA...

Protein

Download Protein FASTA

139 aa · LXL04_014627|LXL04_014627|OH1004|PROTEIN

MMKGLFRGLRCMFDTDDEKEPEIQIGNPTDVKHVAHIGCDGPSTPAPSWMNEYQGDSQSGDKKAGPKDLGAAAASPSRHGKQSKTRKSKTSKSSILGSDSQEQSGKKTRKKKGEVTTRSSKTRNKDSDSGCSDGVCKKP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014627`
TK1151 ID	TkA02G407250
OH-1004 ID	LXL04_014627
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014627

Location Chr03:54154698-54155927 (+)

Description Similar to RIC7: CRIB domain-containing protein RIC7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g28556`	Functions as a downstream effector of Rho-related GTP binding proteins of the 'Rho of Plants' (ROPs) family.	No verified direct reference in this release
`At2g33460`	Functions as a downstream effector of Rho-related GTP binding proteins of the 'Rho of Plants' (ROPs) family.	No verified direct reference in this release
`At3g23380`	Functions as a downstream effector of Rho-related GTP binding proteins of the 'Rho of Plants' (ROPs) family.	No verified direct reference in this release
`At2g20430`	Functions as a downstream effector of Rho-related GTP binding proteins of the 'Rho of Plants' (ROPs) family.	No verified direct reference in this release
`At1g04450`	Functions as a downstream effector of Rho-related GTP binding proteins of the 'Rho of Plants' (ROPs) family.	A genome-wide analysis of Arabidopsis Rop-interactive CRIB motif-containing proteins that act as Rop GTPase targets.2001 · DOI: 10.1105/tpc.010218 A Rho family GTPase controls actin dynamics and tip growth via two counteracting downstream pathways in pollen tubes.2005 · DOI: 10.1083/jcb.200409140

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014627 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000902 cell morphogenesis Biological Process

GO:0007204 positive regulation of cytosolic calcium ion concentration Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010215 cellulose microfibril organization Biological Process

GO:0017157 regulation of exocytosis Biological Process

GO:0030834 regulation of actin filament depolymerization Biological Process

GO:0031122 cytoplasmic microtubule organization Biological Process

GO:0050848 regulation of calcium-mediated signaling Biological Process

GO:0050850 positive regulation of calcium-mediated signaling Biological Process

GO:0051650 establishment of vesicle localization Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G04450

ath:AT2G20430

ath:AT2G33460

ath:AT3G23380

ath:AT4G28556

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.516

Rank 1 · LXL04_014627 · OH-1004

Cell membrane0.337

Rank 2 · LXL04_014627 · OH-1004

Nucleus0.311

Rank 3 · LXL04_014627 · OH-1004

Mitochondrion0.062

Rank 4 · LXL04_014627 · OH-1004

Endoplasmic reticulum0.058

Rank 5 · LXL04_014627 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1G3K8`	Arabidopsis thaliana	CRIB domain-containing protein RIC7	40.426%	Swiss-Prot	moderate database homology
`F4IVV0`	Arabidopsis thaliana	CRIB domain-containing protein RIC1	39.823%	Swiss-Prot	moderate database homology
`F4J424`	Arabidopsis thaliana	CRIB domain-containing protein RIC5	59.322%	Swiss-Prot	weak database homology
`Q1PF35`	Arabidopsis thaliana	CRIB domain-containing protein RIC6	65.455%	Swiss-Prot	weak database homology
`F4I5N6`	Arabidopsis thaliana	CRIB domain-containing protein RIC3	57.407%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card