RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_014496
Reference: OH-1004 Chr: Chr03 Coordinates: 50579837-50583610 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3774 bp · LXL04_014496|LXL04_014496|OH1004|cDNA

ATGACAAACCCAAATTCAAGATCAAAAGCCTTTCATCTCCTCATACTACTATTCCTGTGTTTTATCCACCTGTGTTTCTCCAATGACACTTCATCATTGATAACTCTTCGAAAATTACTGCTTCAAAGAAAAGACGTTACATCAACATGGTttaattcaaacacacatcCATGTAACTGGACTGGCATAAGATGTGAAGGTTCTTCCGTTCATCAAATATCTCTCTCCTGTACATTCTCTCCACTCACTCTCCCATTCCC...

CDS

Download CDS FASTA

3774 bp · LXL04_014496|LXL04_014496|OH1004|CDS

ATGACAAACCCAAATTCAAGATCAAAAGCCTTTCATCTCCTCATACTACTATTCCTGTGTTTTATCCACCTGTGTTTCTCCAATGACACTTCATCATTGATAACTCTTCGAAAATTACTGCTTCAAAGAAAAGACGTTACATCAACATGGTTTAATTCAAACACACATCCATGTAACTGGACTGGCATAAGATGTGAAGGTTCTTCCGTTCATCAAATATCTCTCTCCTGTACATTCTCTCCACTCACTCTCCCATTCCC...

Protein

Download Protein FASTA

1257 aa · LXL04_014496|LXL04_014496|OH1004|PROTEIN

MTNPNSRSKAFHLLILLFLCFIHLCFSNDTSSLITLRKLLLQRKDVTSTWFNSNTHPCNWTGIRCEGSSVHQISLSCTFSPLTLPFPKTLQEFKSLKHLNVSGCGFNGRIYSDFWTLNDLETLDLSDNRLFGVLDNNTFSSLKKLKVLVLDSNRFSGSLPETIGQLGNLTELSVKSNSFSGRLPYEIGNLDKLQSLDLSLNLFSGDLPSSLGNLSKLLFLDASHNLFTGLLFSKIGNLKKLRTLDLSMNSFGGQIPGTIG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_014496
TK1151 IDTkA02G421120
OH-1004 IDLXL04_014496
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_014496
LocationChr03:50579837-50583610 (-)
DescriptionSimilar to MSP1: Leucine-rich repeat receptor protein kinase MSP1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g07280 Receptor with a serine/threonine-protein kinase activity required for the specification of the correct number of male archesporial initials and for the subsequent specification of tapetal and middle cell layer identities. No verified direct reference in this release
At4g20140 Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.
GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x
The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066
A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057
At1g55610 Receptor with a serine/threonine-protein kinase activity.
BRL1, a leucine-rich repeat receptor-like protein kinase, is functionally redundant with BRI1 in regulating Arabidopsis brassinosteroid signaling.2004 · DOI: 10.1111/j.1365-313x.2004.02214.x
BRL1 and BRL3 are novel brassinosteroid receptors that function in vascular differentiation in Arabidopsis.2004 · DOI: 10.1242/dev.01403

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0917500 Receptor-like kinase that plays important roles in restricting the number of cells entering into male and female sporogenesis.
The MSP1 gene is necessary to restrict the number of cells entering into male and female sporogenesis and to initiate anther wall formation in rice.2003 · DOI: 10.1105/tpc.012401
Os02g0194400 Receptor-like kinase that may play a role male and female sporogenesis. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_014496 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0009414 response to water deprivation Biological Process
GO:0009416 response to light stimulus Biological Process
GO:0009554 megasporogenesis Biological Process
GO:0009556 microsporogenesis Biological Process
GO:0009611 response to wounding Biological Process
GO:0009729 detection of brassinosteroid stimulus Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0009755 hormone-mediated signaling pathway Biological Process
GO:0009791 post-embryonic development Biological Process
GO:0010234 anther wall tapetum cell fate specification Biological Process
GO:0042659 regulation of cell fate specification Biological Process
GO:0045184 establishment of protein localization Biological Process
KEGG gene cross-reference
ath:AT1G55610
ath:AT4G20140
ath:AT5G07280
dosa:Os01g0917500
dosa:Os02g0194400
osa:4324355
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.857
Rank 1 · LXL04_014496 · OH-1004
Endoplasmic reticulum0.086
Rank 2 · LXL04_014496 · OH-1004
Cytoplasm0.063
Rank 3 · LXL04_014496 · OH-1004
Nucleus0.043
Rank 4 · LXL04_014496 · OH-1004
Lysosome / Vacuole0.029
Rank 5 · LXL04_014496 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_227-65 aa
PF13855.13LRR_8120-178 aa
PF23598.2LRR_14182-224 aa
PF23598.2LRR_14232-411 aa
PF13855.13LRR_8236-274 aa
PF12799.14LRR_4548-585 aa
PF13855.13LRR_8549-608 aa
PF13855.13LRR_8637-692 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_014496PF08263.18LRRNT_227653.1e-0834.5
LXL04_014496PF13855.13LRR_81201781.8e-48162.8
LXL04_014496PF23598.2LRR_141822242.2e-36126.1
LXL04_014496PF23598.2LRR_142324112.2e-36126.1
LXL04_014496PF13855.13LRR_82362741.8e-48162.8
LXL04_014496PF12799.14LRR_45485853.9e-36123.0
LXL04_014496PF13855.13LRR_85496081.8e-48162.8
LXL04_014496PF13855.13LRR_86376921.8e-48162.8
LXL04_014496PF13855.13LRR_86807401.8e-48162.8
LXL04_014496PF12799.14LRR_47047413.9e-36123.0
LXL04_014496PF13855.13LRR_87057641.8e-48162.8
LXL04_014496PF23598.2LRR_147428372.2e-36126.1
LXL04_014496PF12799.14LRR_48038363.9e-36123.0
LXL04_014496PF00069.32Pkinase97812442.7e-40139.1
LXL04_014496PF07714.24PK_Tyr_Ser-Thr98112463.4e-42145.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LYN8Arabidopsis thalianaLeucine-rich repeat receptor protein kinase EMS144.943%Swiss-Protmoderate database homology
C0LGQ5Arabidopsis thalianaLRR receptor-like serine/threonine-protein kinase GSO132.222%Swiss-Protmoderate database homology
Q9ZWC8Arabidopsis thalianaSerine/threonine-protein kinase BRI1-like 134.799%Swiss-Protmoderate database homology
Q8RZV7Oryza sativa subsp. japonicaLeucine-rich repeat receptor protein kinase MSP152.726%Swiss-Protstrong database homology
Q7F8Q9Oryza sativa subsp. japonicaLeucine-rich repeat receptor protein kinase MSL145.065%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser