LXL04_014456 | RubberDandelionOmics

Gene overview

LXL04_014456

Reference: OH-1004 Chr: Chr03 Coordinates: 49532978-49536931 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1608 bp · LXL04_014456|LXL04_014456|OH1004|cDNA

ATGGAAGCTCTTAGAGCTCCCTCCCCGGTTTCTCCATCTTCACTGGTCAGAACACATTTGCCCAAACCCATTCTCAGTCTTTCATTTGCTCAGAAAACCCCCAATTCACCCTTACCCTCTCTAACCCAATTTACAAAATCCAAATTCAGGAACTTCACTGCTATTTCCCCATCCGTCTCAACGGAACCCACTTCCCCACCTGAAGAAGAACCCGAAACCCTTAATCAAGATGAAAAATTCGACTGGTTTTCTCAGTGGTA...

CDS

Download CDS FASTA

1608 bp · LXL04_014456|LXL04_014456|OH1004|CDS

ATGGAAGCTCTTAGAGCTCCCTCCCCGGTTTCTCCATCTTCACTGGTCAGAACACATTTGCCCAAACCCATTCTCAGTCTTTCATTTGCTCAGAAAACCCCCAATTCACCCTTACCCTCTCTAACCCAATTTACAAAATCCAAATTCAGGAACTTCACTGCTATTTCCCCATCCGTCTCAACGGAACCCACTTCCCCACCTGAAGAAGAACCCGAAACCCTTAATCAAGATGAAAAATTCGACTGGTTTTCTCAGTGGTA...

Protein

Download Protein FASTA

535 aa · LXL04_014456|LXL04_014456|OH1004|PROTEIN

MEALRAPSPVSPSSLVRTHLPKPILSLSFAQKTPNSPLPSLTQFTKSKFRNFTAISPSVSTEPTSPPEEEPETLNQDEKFDWFSQWYALMPVCDLDKRAPHGKKVLGLDVVVWWDKNDNEWKVFNDSCPHRLAPLSEGRIDQWGRLQCVYHGWCFSGSGDCKLIPQAPPDGPPVNTFQKACVAVYPSTVQNGIVWFWPNSDPKYKDILTTKKPPYIPQLDDPSFTFQMYNRDIPYGYEILIENLMDPAHQDREGGRPLDI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014456`
TK1151 ID	TkA02G424260
OH-1004 ID	LXL04_014456
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.500
Protein coverage (%)	TK1151 95.725 / OH-1004 93.084 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014456

Location Chr03:49532978-49536931 (+)

Description Similar to PTC52: Protochlorophyllide-dependent translocon component 52, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g25650`	Part of a translocon most abundantly expressed in etiolated plants and involved in the protochlorophyllide-dependent import of the precursor NADPH:protochlorophyllide oxidoreductase A (pPORA).	No verified direct reference in this release
`At3g44880`	Catalyzes the key reaction of chlorophyll catabolism, porphyrin macrocycle cleavage of pheophorbide a (pheide a) to a primary fluorescent catabolite (pFCC).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0146400`	Catalyzes the key reaction of chlorophyll catabolism, porphyrin macrocycle cleavage of pheophorbide a (pheide a) to a primary fluorescent catabolite (pFCC).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014456 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009812 flavonoid metabolic process Biological Process

GO:0009908 flower development Biological Process

GO:0010154 fruit development Biological Process

GO:0012501 programmed cell death Biological Process

GO:0015031 protein transport Biological Process

GO:0015996 chlorophyll catabolic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

KEGG gene cross-reference

ath:AT3G44880

ath:AT4G25650

osa:4331611

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.974

Rank 1 · LXL04_014456 · OH-1004

Mitochondrion0.034

Rank 2 · LXL04_014456 · OH-1004

Cytoplasm0.023

Rank 3 · LXL04_014456 · OH-1004

Peroxisome0.016

Rank 4 · LXL04_014456 · OH-1004

Nucleus0.016

Rank 5 · LXL04_014456 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00355.33Rieske85-175 aa

PF08417.19PaO281-383 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014456	`PF00355.33`	Rieske	85	175	4.3e-25	88.1
LXL04_014456	`PF08417.19`	PaO	281	383	4e-24	85.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W496`	Arabidopsis thaliana	Protochlorophyllide-dependent translocon component 52, chloroplastic	53.690%	Swiss-Prot	strong database homology
`Q9FYC2`	Arabidopsis thaliana	Pheophorbide a oxygenase, chloroplastic	32.685%	Swiss-Prot	moderate database homology
`Q0DV66`	Oryza sativa subsp. japonica	Pheophorbide a oxygenase, chloroplastic	36.601%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card