LXL04_014443 | RubberDandelionOmics

Gene overview

LXL04_014443

Reference: OH-1004 Chr: Chr03 Coordinates: 49333471-49333995 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

369 bp · LXL04_014443|LXL04_014443|OH1004|cDNA

ATGAAGAAGCTACCTCCTAAAAAGGAGCTGATTTTACGTGTGGAGTTAAGTAGCAAGCAGAAAGAGTACTATAAGGCTATTTTAACTCGTAACTATCAGTTGTTAACTCGCAGAGGAGGTGCTCAGATTTCTCTGATTAATGTGGTTATGGAATTGCGTAAGCTCTGTTGCCACCCTTTTATGCTGGAAGGAGTCGAACCAGAAGATAATAACGAGTTTTACAaACAACTGTGTGAATCTTCTGGGAAACTGCAGCTTTT...

CDS

Download CDS FASTA

369 bp · LXL04_014443|LXL04_014443|OH1004|CDS

ATGAAGAAGCTACCTCCTAAAAAGGAGCTGATTTTACGTGTGGAGTTAAGTAGCAAGCAGAAAGAGTACTATAAGGCTATTTTAACTCGTAACTATCAGTTGTTAACTCGCAGAGGAGGTGCTCAGATTTCTCTGATTAATGTGGTTATGGAATTGCGTAAGCTCTGTTGCCACCCTTTTATGCTGGAAGGAGTCGAACCAGAAGATAATAACGAGTTTTACAAACAACTGTGTGAATCTTCTGGGAAACTGCAGCTTTT...

Protein

Download Protein FASTA

122 aa · LXL04_014443|LXL04_014443|OH1004|PROTEIN

MKKLPPKKELILRVELSSKQKEYYKAILTRNYQLLTRRGGAQISLINVVMELRKLCCHPFMLEGVEPEDNNEFYKQLCESSGKLQLLDKMMVNLKEQGHRVLIYTQFQHMLDLLEDYFNNKV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014443`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014443

Location Chr03:49333471-49333995 (+)

Description Similar to PKL: CHD3-type chromatin-remodeling factor PICKLE

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g25170`	Chromatin remodeling factor that represses the expression of embryonic trait genes (such as NFYB9/LEC1) upon and after seed germination and thus enables the developmental switch to post-germinative growth.	No verified direct reference in this release
`At4g31900`	Chromatin remodeling factor that represses the expression of embryonic trait genes upon and after seed germination and thus enables the developmental switch to post-germinative growth.	No verified direct reference in this release
`At5g44800`	Chromatin-remodeling protein that binds DNA through histones and regulates gene transcription.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014443 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0007051 spindle organization Biological Process

GO:0007098 centrosome cycle Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009733 response to auxin Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009739 response to gibberellin Biological Process

KEGG gene cross-reference

ath:AT2G25170

ath:AT4G31900

ath:AT5G44800

hsa:1107

hsa:26038

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.786

Rank 1 · LXL04_014443 · OH-1004

Cytoplasm0.312

Rank 2 · LXL04_014443 · OH-1004

Mitochondrion0.028

Rank 3 · LXL04_014443 · OH-1004

Cell membrane0.016

Rank 4 · LXL04_014443 · OH-1004

Endoplasmic reticulum0.014

Rank 5 · LXL04_014443 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00176.30SNF2-rel_dom2-61 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014443	`PF00176.30`	SNF2-rel_dom	2	61	9.9e-10	38.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S775`	Arabidopsis thaliana	CHD3-type chromatin-remodeling factor PICKLE	79.675%	Swiss-Prot	strong database homology
`F4JTF6`	Arabidopsis thaliana	CHD3-type chromatin-remodeling factor CHR7	66.942%	Swiss-Prot	strong database homology
`F4KBP5`	Arabidopsis thaliana	Protein CHROMATIN REMODELING 4	48.780%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card