LXL04_014399 | RubberDandelionOmics

Gene overview

LXL04_014399

Reference: OH-1004 Chr: Chr03 Coordinates: 48357936-48361312 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

960 bp · LXL04_014399|LXL04_014399|OH1004|cDNA

ATGTCCTTAACTCATTTCCCTTTTAACCTACCAGAAACACTCTGGTGGACGCAGCAACACCCATACCCTATTATGGACTCCTCCCCCAAACCCCCCGTCTTTTCCACCGACCAACACCACCATCAACCGCCCACAACCGCCTTCAATTTTGACATCAACAACCAGTATTACCACCACCAGCAAGAATCCCAAGAACAGGATTCCGCCGACCAGCAGCTTCCGAAAGAACCCATGTTCGAGAAGCCATTAACGCCCAGCGA...

CDS

Download CDS FASTA

960 bp · LXL04_014399|LXL04_014399|OH1004|CDS

ATGTCCTTAACTCATTTCCCTTTTAACCTACCAGAAACACTCTGGTGGACGCAGCAACACCCATACCCTATTATGGACTCCTCCCCCAAACCCCCCGTCTTTTCCACCGACCAACACCACCATCAACCGCCCACAACCGCCTTCAATTTTGACATCAACAACCAGTATTACCACCACCAGCAAGAATCCCAAGAACAGGATTCCGCCGACCAGCAGCTTCCGAAAGAACCCATGTTCGAGAAGCCATTAACGCCCAGCGA...

Protein

Download Protein FASTA

319 aa · LXL04_014399|LXL04_014399|OH1004|PROTEIN

MSLTHFPFNLPETLWWTQQHPYPIMDSSPKPPVFSTDQHHHQPPTTAFNFDINNQYYHHQQESQEQDSADQQLPKEPMFEKPLTPSDVGKLNRLVIPKQYAEKYFPLGGADSASAAAADQQKGLLLSFEDESGKPWRFRYSYWNSSQSYVLTKGWSRFVKEKRLDAGDVVLFERHRFDCDRLFIGWRRRPVQDSIAVAPPTGAGAQISGWTTGVLYDAQYTYPSHHLTPSRPHPYQPDSLHAGDNVENNRRDMVSSGNNP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014399`
TK1151 ID	TkA02G429580
OH-1004 ID	LXL04_014399
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014399

Location Chr03:48357936-48361312 (-)

Description Similar to At5g06250: B3 domain-containing protein At5g06250

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06250`	B3 domain-containing protein At5g06250.	No verified direct reference in this release
`At3g11580`	B3 domain-containing protein At3g11580.	No verified direct reference in this release
`At2g36080`	B3 domain-containing protein At2g36080.	No verified direct reference in this release
`At3g61970`	Regulates lateral organ growth.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0156000`	B3 domain-containing protein Os11g0156000.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014399 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009908 flower development Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010358 leaf shaping Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048366 leaf development Biological Process

GO:0048507 meristem development Biological Process

GO:0080113 regulation of seed growth Biological Process

GO:1901371 regulation of leaf morphogenesis Biological Process

GO:1902075 cellular response to salt Biological Process

KEGG gene cross-reference

ath:AT2G36080

ath:AT3G11580

ath:AT3G61970

ath:AT5G06250

dosa:Os11g0156000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.957

Rank 1 · LXL04_014399 · OH-1004

Cytoplasm0.110

Rank 2 · LXL04_014399 · OH-1004

Endoplasmic reticulum0.038

Rank 3 · LXL04_014399 · OH-1004

Cell membrane0.033

Rank 4 · LXL04_014399 · OH-1004

Plastid0.011

Rank 5 · LXL04_014399 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02362.27B379-189 aa

PF31239.1At5g26805_C80-170 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014399	`PF02362.27`	B3	79	189	1.5e-27	96.2
LXL04_014399	`PF31239.1`	At5g26805_C	80	170	1.7e-06	29.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNI3`	Arabidopsis thaliana	B3 domain-containing protein At5g06250	56.500%	Swiss-Prot	moderate database homology
`Q8RYD3`	Arabidopsis thaliana	B3 domain-containing protein At3g11580	49.027%	Swiss-Prot	moderate database homology
`Q8GYJ2`	Arabidopsis thaliana	B3 domain-containing protein At2g36080	53.125%	Swiss-Prot	moderate database homology
`Q9M268`	Arabidopsis thaliana	B3 domain-containing transcription factor NGA2	44.118%	Swiss-Prot	moderate database homology
`Q53QI0`	Oryza sativa subsp. japonica	B3 domain-containing protein Os11g0156000	50.000%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card