Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2535 bp · LXL04_014307|LXL04_014307|OH1004|cDNA
ATGGCATCTTTGCAGATTGAAGTggcttcatcttcttctccatTTACTTACTCTCGCAGGGATCATCACACTCATTCCAAAAACATCACGGGGTATATGACCCAGTGTATCCGCAAGAACAAAGCTCATGATGACGACGAGGATTCATCATGGCTTCCCTCCCACAATTCCAAAACCGATGATTCTTGGCTTCCCGTTCACGTAACCTCAAAATCAAACGCTTCTAATCACCGGAAAGGACAAACCGATGTTGATGATTC...
2535 bp · LXL04_014307|LXL04_014307|OH1004|CDS
ATGGCATCTTTGCAGATTGAAGTGGCTTCATCTTCTTCTCCATTTACTTACTCTCGCAGGGATCATCACACTCATTCCAAAAACATCACGGGGTATATGACCCAGTGTATCCGCAAGAACAAAGCTCATGATGACGACGAGGATTCATCATGGCTTCCCTCCCACAATTCCAAAACCGATGATTCTTGGCTTCCCGTTCACGTAACCTCAAAATCAAACGCTTCTAATCACCGGAAAGGACAAACCGATGTTGATGATTC...
Protein
Download Protein FASTA844 aa · LXL04_014307|LXL04_014307|OH1004|PROTEIN
MASLQIEVASSSSPFTYSRRDHHTHSKNITGYMTQCIRKNKAHDDDEDSSWLPSHNSKTDDSWLPVHVTSKSNASNHRKGQTDVDDSWLPANNDTKGKGWKNTSQPHKDIDYSWLPSTYIDNKDKKHKHDKIKDKSKNNAHTNTTKNNNSKNNINISTNSNSVTSQKISTNNHWALAREVVFSSDEQDAPSISRSTVESPSSEGVSSLLRRWSAFAEEKNSNNDGNQSPASSSRSNLGSTKESKSSTHSPPSATKYSNWE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_014307 |
|---|---|
| TK1151 ID | TkA02G440350 |
| OH-1004 ID | LXL04_014307 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 98.400 |
| Protein coverage (%) | TK1151 80.753 / OH-1004 22.867Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_014307 |
|---|---|
| Location | Chr03:45814977-45818166 (+) |
| Description | Protein of unknown function |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000209 protein polyubiquitination Biological Process GO:0008104 intracellular protein localization Biological Process GO:0008356 asymmetric cell division Biological Process GO:0008593 regulation of Notch signaling pathway Biological Process GO:0030718 germ-line stem cell population maintenance Biological Process GO:0045747 positive regulation of Notch signaling pathway Biological Process GO:0045807 positive regulation of endocytosis Biological Process GO:0070086 ubiquitin-dependent endocytosis Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005768 endosome Cellular Component GO:0005829 cytosol Cellular Component |
| KEGG gene cross-reference | dme:Dmel_CG11988 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13920.13zf-C3HC4_3781-837 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_014307 | PF13920.13 | zf-C3HC4_3 | 781 | 837 | 1.3e-06 | 28.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.