LXL04_014294 | RubberDandelionOmics

Gene overview

LXL04_014294

Reference: OH-1004 Chr: Chr03 Coordinates: 45559458-45560764 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

570 bp · LXL04_014294|LXL04_014294|OH1004|cDNA

ATGAGCGAAGATTCATCCAGTAGTACCGTTACTGATGGCGGTGGTGCAAACGCAAATGAAGCAGAGAAGACTACAATAGAGCCAATTCGAATGCCTACTGTAGAAGAAATTAGGGGACAAGATATATGGAACAATTGTGCTGTTCGCAGCGTTGCCAGCGGAGTCATGGGAGGTGGACTTGGGTTGGCTATGGGGTTGTTTCTTGGTGCACTTGACAATCCAATAATGCAGGATGAAATGAGTGGTAGACAGCAGTTTAT...

CDS

Download CDS FASTA

570 bp · LXL04_014294|LXL04_014294|OH1004|CDS

ATGAGCGAAGATTCATCCAGTAGTACCGTTACTGATGGCGGTGGTGCAAACGCAAATGAAGCAGAGAAGACTACAATAGAGCCAATTCGAATGCCTACTGTAGAAGAAATTAGGGGACAAGATATATGGAACAATTGTGCTGTTCGCAGCGTTGCCAGCGGAGTCATGGGAGGTGGACTTGGGTTGGCTATGGGGTTGTTTCTTGGTGCACTTGACAATCCAATAATGCAGGATGAAATGAGTGGTAGACAGCAGTTTAT...

Protein

Download Protein FASTA

189 aa · LXL04_014294|LXL04_014294|OH1004|PROTEIN

MSEDSSSSTVTDGGGANANEAEKTTIEPIRMPTVEEIRGQDIWNNCAVRSVASGVMGGGLGLAMGLFLGALDNPIMQDEMSGRQQFIYTAKQMGRRSWGSCKAFAVMGFIFSAAECVVEQAINKLILYLKARAKHDMTNTVVAGCVTGGAISAKGNYFFTSGPKAACVGCAGFAAFSVVIEKFLDRHEG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014294`
TK1151 ID	TkA02G441240
OH-1004 ID	LXL04_014294
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014294

Location Chr03:45559458-45560764 (-)

Description Similar to TIM22-1: Mitochondrial import inner membrane translocase subunit TIM22-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g10110`	Essential core component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane.	Characterization of the preprotein and amino acid transporter gene family in Arabidopsis.2007 · DOI: 10.1104/pp.106.090688
`At1g18320`	Essential core component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014294 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0045039 protein insertion into mitochondrial inner membrane Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0042721 TIM22 mitochondrial import inner membrane insertion complex Cellular Component

GO:0005198 structural molecule activity Molecular Function

GO:0008320 protein transmembrane transporter activity Molecular Function

GO:0030943 mitochondrion targeting sequence binding Molecular Function

KEGG gene cross-reference

ath:AT1G18320

ath:AT3G10110

cal:CAALFM_C208310WA

cgr:2888408

kla:KLLA0_D08536g

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.850

Rank 1 · LXL04_014294 · OH-1004

Plastid0.104

Rank 2 · LXL04_014294 · OH-1004

Cytoplasm0.059

Rank 3 · LXL04_014294 · OH-1004

Nucleus0.035

Rank 4 · LXL04_014294 · OH-1004

Cell membrane0.017

Rank 5 · LXL04_014294 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02466.25Tim1746-177 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014294	`PF02466.25`	Tim17	46	177	7.2e-24	85.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A2RVP7`	Arabidopsis thaliana	Mitochondrial import inner membrane translocase subunit TIM22-1	65.054%	Swiss-Prot	strong database homology
`A1XJK0`	Arabidopsis thaliana	Mitochondrial import inner membrane translocase subunit TIM22-4	70.064%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card