Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2799 bp · LXL04_014265|LXL04_014265|OH1004|cDNA
ATGGGATGTGGGGATGCTATGGATTGGCCAGATGATTGTGAGAAGTTTTTATTAGAAATTTTGGCTGAAAGGATTAAGAAAGATCCTAATGGGGCTCTACGAGATAAGATGTTCAAAACATTCAAGAAAAAGGGTTGCAAGATTTATCCTTTAATGGGAGTTGTATTTAGTGGTTCTACAGCATCTGGTACTTTTCATAATGCCTCAACGTGTGCTCCACAGACATCAGAAGAAGAGCGTAGAATTGAGGATGAGTATCT...
2799 bp · LXL04_014265|LXL04_014265|OH1004|CDS
ATGGGATGTGGGGATGCTATGGATTGGCCAGATGATTGTGAGAAGTTTTTATTAGAAATTTTGGCTGAAAGGATTAAGAAAGATCCTAATGGGGCTCTACGAGATAAGATGTTCAAAACATTCAAGAAAAAGGGTTGCAAGATTTATCCTTTAATGGGAGTTGTATTTAGTGGTTCTACAGCATCTGGTACTTTTCATAATGCCTCAACGTGTGCTCCACAGACATCAGAAGAAGAGCGTAGAATTGAGGATGAGTATCT...
Protein
Download Protein FASTA932 aa · LXL04_014265|LXL04_014265|OH1004|PROTEIN
MGCGDAMDWPDDCEKFLLEILAERIKKDPNGALRDKMFKTFKKKGCKIYPLMGVVFSGSTASGTFHNASTCAPQTSEEERRIEDEYLDVSSFNSVGESGESGQKGKRKAEGDLEGIIPGTRREKKSAGSFKYDALLDAWSESMIARKERDLAKAEQYKSKQDDITSSLVEEYSIGDCMIALEATLGSDTMSDSSDSSSYSDDNDEDLDDMMMFFFLIKHKKSFIDRIPCRTSMLSGKEYIREIMCGNPIQCYEAIRMKPH...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_014265 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_014265 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:44946338-44950609 (-) | |||||||||
| Description | Similar to ALP1: Protein ANTAGONIST OF LIKE HETEROCHROMATIN PROTEIN 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0040029 epigenetic regulation of gene expression Biological Process GO:0000118 histone deacetylase complex Cellular Component GO:0005634 nucleus Cellular Component GO:0035098 ESC/E(Z) complex Cellular Component GO:0035102 PRC1 complex Cellular Component GO:0003682 chromatin binding Molecular Function GO:0004518 nuclease activity Molecular Function GO:0016787 hydrolase activity Molecular Function GO:0046872 metal ion binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT3G55350 ath:AT3G63270 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF26138.1DUF8040231-325 aaPF13359.13DDE_Tnp_4362-487 aaPF26138.1DUF8040587-681 aaPF13359.13DDE_Tnp_4718-864 aaPF04827.21Plant_tran812-872 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_014265 | PF26138.1 | DUF8040 | 231 | 325 | 5.9e-66 | 219.1 |
| LXL04_014265 | PF13359.13 | DDE_Tnp_4 | 362 | 487 | 3.9e-29 | 102.0 |
| LXL04_014265 | PF26138.1 | DUF8040 | 587 | 681 | 5.9e-66 | 219.1 |
| LXL04_014265 | PF13359.13 | DDE_Tnp_4 | 718 | 864 | 3.9e-29 | 102.0 |
| LXL04_014265 | PF04827.21 | Plant_tran | 812 | 872 | 1.3e-16 | 61.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.