LXL04_014224 | RubberDandelionOmics

Gene overview

LXL04_014224

Reference: OH-1004 Chr: Chr03 Coordinates: 43921813-43927367 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1917 bp · LXL04_014224|LXL04_014224|OH1004|cDNA

ATGCAAGCACAAACACCGGGCAGCGTCTCCGTCTTTTCATCGTTCGCAGAGGAAATGGGGTATAAACGTAAATTTGGTCAGGATGATGTTCCAAGCCACGGTGCAATATTTATGTCAAATATCGGAACAAAGAAAGAGTGTTTCCAACGTAAGCTGTTTGGGCTTCCTTTAGCTCAGTCCGATTTTGTGTTACATGTGAAAAAAGGAATGATTCTTTTCCTTTTTGAGTTTGAGAAGCGACAACTCCATGGTGTATTTCG...

CDS

Download CDS FASTA

1917 bp · LXL04_014224|LXL04_014224|OH1004|CDS

ATGCAAGCACAAACACCGGGCAGCGTCTCCGTCTTTTCATCGTTCGCAGAGGAAATGGGGTATAAACGTAAATTTGGTCAGGATGATGTTCCAAGCCACGGTGCAATATTTATGTCAAATATCGGAACAAAGAAAGAGTGTTTCCAACGTAAGCTGTTTGGGCTTCCTTTAGCTCAGTCCGATTTTGTGTTACATGTGAAAAAAGGAATGATTCTTTTCCTTTTTGAGTTTGAGAAGCGACAACTCCATGGTGTATTTCG...

Protein

Download Protein FASTA

638 aa · LXL04_014224|LXL04_014224|OH1004|PROTEIN

MQAQTPGSVSVFSSFAEEMGYKRKFGQDDVPSHGAIFMSNIGTKKECFQRKLFGLPLAQSDFVLHVKKGMILFLFEFEKRQLHGVFRATSNGEIDIDPNAFKSSGYRFPAQVPFTSVWNCNPLFEHEFKDAIRDNYFSWKKFKFGLSKDQVYNLMSLFRSKRISNNDPPRPCLRYHDDKPAKRDTRFDDNRKRVRDTIKFIKEDSHGFDIDEVDNQSFRTLRKERSHKDNKNVFLTNCNKESDDFGDCGSRKIDKHLDRS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014224`
TK1151 ID	TkA02G446770
OH-1004 ID	LXL04_014224
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 89.844 / OH-1004 17.868 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014224

Location Chr03:43921813-43927367 (+)

Description Similar to B2 protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42050`	Contributes to the initial phase of responses to abiotic and biotic stress signals (Probable).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014224 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0034976 response to endoplasmic reticulum stress Biological Process

GO:0043067 regulation of programmed cell death Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1902074 response to salt Biological Process

GO:1904350 regulation of protein catabolic process in the vacuole Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT5G42050

gmx:100808989

gmx:547685

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.927

Rank 1 · LXL04_014224 · OH-1004

Cytoplasm0.136

Rank 2 · LXL04_014224 · OH-1004

Cell membrane0.037

Rank 3 · LXL04_014224 · OH-1004

Endoplasmic reticulum0.018

Rank 4 · LXL04_014224 · OH-1004

Plastid0.012

Rank 5 · LXL04_014224 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10539.15Dev_Cell_Death34-158 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014224	`PF10539.15`	Dev_Cell_Death	34	158	2.5e-48	163.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXN8`	Arabidopsis thaliana	DCD domain-containing protein NRP	37.984%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card