RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_014070
Reference: OH-1004 Chr: Chr03 Coordinates: 41630201-41633884 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2403 bp · LXL04_014070|LXL04_014070|OH1004|cDNA

ATGAGGAGCGGCATCGAGGGGAGGACTATGGcggtggaggaggaggaggataggcGGAGGAAGGCGGCAGGGGAGGAGGATGGAGTGATAGAGGAGTACGATGTTAATAATCTTGGAGATATCGGAAGGTTAGGAAAACGACAATGTGAGTGGGACTTCGGGACTAGCAGTGACAAAGTTGCTAATGGCAGAAAAGGCTCTTCTCATGGTCTCTTCATTCACCCTCGAAACAGATGGTACCGGACTTGGGAGAAATTCAT...

CDS

Download CDS FASTA

2403 bp · LXL04_014070|LXL04_014070|OH1004|CDS

ATGAGGAGCGGCATCGAGGGGAGGACTATGGCGGTGGAGGAGGAGGAGGATAGGCGGAGGAAGGCGGCAGGGGAGGAGGATGGAGTGATAGAGGAGTACGATGTTAATAATCTTGGAGATATCGGAAGGTTAGGAAAACGACAATGTGAGTGGGACTTCGGGACTAGCAGTGACAAAGTTGCTAATGGCAGAAAAGGCTCTTCTCATGGTCTCTTCATTCACCCTCGAAACAGATGGTACCGGACTTGGGAGAAATTCAT...

Protein

Download Protein FASTA

800 aa · LXL04_014070|LXL04_014070|OH1004|PROTEIN

MRSGIEGRTMAVEEEEDRRRKAAGEEDGVIEEYDVNNLGDIGRLGKRQCEWDFGTSSDKVANGRKGSSHGLFIHPRNRWYRTWEKFILLWAVYSSFFTPMEFGFFKGLPNHLCLLDIITQAVFFIDIVLQFFLAYRDIDTEKMIFNRNLISLRYLQSHFIPDLFACIPWDTIYKACGRKEELRFLLLIRLVRTRKVLEFFSKLEKDIRVKYLFSRILKLIVVELYCTHTAACIFYYLATTLPAGQEEYTWIGSLKLGDYS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_014070
TK1151 IDTkA02G456830
OH-1004 IDLXL04_014070
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)96.300
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_014070
LocationChr03:41630201-41633884 (-)
DescriptionSimilar to SKOR: Potassium channel SKOR
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g02850 Highly selective outward-rectifying potassium channel.
Identification and disruption of a plant shaker-like outward channel involved in K+ release into the xylem sap.1998 · DOI: 10.1016/s0092-8674(00)81606-2
At5g37500 Major selective outward-rectifying potassium channel of the guard cell membrane.
The Arabidopsis outward K+ channel GORK is involved in regulation of stomatal movements and plant transpiration.2003 · DOI: 10.1073/pnas.0733970100

Rice

Reference gene IDPossible functionPapers / DOI
Os06g0250600 Probable outward-rectifying potassium channel. No verified direct reference in this release
Os04g0445000 Probable outward-rectifying potassium channel. No verified direct reference in this release
Os05g0428700 Probable inward-rectifying potassium channel. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_014070 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006811 monoatomic ion transport Biological Process
GO:0006813 potassium ion transport Biological Process
GO:0009409 response to cold Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009753 response to jasmonic acid Biological Process
GO:0010118 stomatal movement Biological Process
GO:0051592 response to calcium ion Biological Process
GO:0055075 potassium ion homeostasis Biological Process
GO:1902458 positive regulation of stomatal opening Biological Process
GO:0005634 nucleus Cellular Component
GO:0005789 endoplasmic reticulum membrane Cellular Component
KEGG gene cross-reference
ath:AT3G02850
ath:AT5G37500
dosa:Os04g0445000
dosa:Os05g0428700
dosa:Os06g0250600
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.640
Rank 1 · LXL04_014070 · OH-1004
Cytoplasm0.163
Rank 2 · LXL04_014070 · OH-1004
Endoplasmic reticulum0.140
Rank 3 · LXL04_014070 · OH-1004
Lysosome / Vacuole0.108
Rank 4 · LXL04_014070 · OH-1004
Golgi apparatus0.073
Rank 5 · LXL04_014070 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00520.38Ion_trans80-329 aa
PF07885.23Ion_trans_2270-326 aa
PF00027.36cNMP_binding420-505 aa
PF12796.14Ank_2554-636 aa
PF13637.13Ank_4557-599 aa
PF13857.13Ank_5565-617 aa
PF00023.37Ank578-607 aa
PF13606.13Ank_3578-606 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_014070PF00520.38Ion_trans803291.8e-30106.7
LXL04_014070PF07885.23Ion_trans_22703262.4e-1040.8
LXL04_014070PF00027.36cNMP_binding4205053e-1659.9
LXL04_014070PF12796.14Ank_25546362.3e-2486.5
LXL04_014070PF13637.13Ank_45575992.3e-1763.4
LXL04_014070PF13857.13Ank_55656173.3e-1453.5
LXL04_014070PF00023.37Ank5786073e-2690.7
LXL04_014070PF13606.13Ank_35786061e-1659.8
LXL04_014070PF13857.13Ank_56326853.3e-1453.5
LXL04_014070PF12796.14Ank_26427002.3e-2486.5
LXL04_014070PF00023.37Ank6496783e-2690.7
LXL04_014070PF11834.14KHA7247953.6e-1969.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9M8S6Arabidopsis thalianaPotassium channel SKOR58.037%Swiss-Protstrong database homology
Q94A76Arabidopsis thalianaPotassium channel GORK58.179%Swiss-Protstrong database homology
Q653P0Oryza sativa subsp. japonicaPotassium channel KOR155.744%Swiss-Protstrong database homology
Q7XUW4Oryza sativa subsp. japonicaPotassium channel KOR249.790%Swiss-Protmoderate database homology
Q75HP9Oryza sativa subsp. japonicaPotassium channel AKT231.047%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser