LXL04_014003 | RubberDandelionOmics

Gene overview

LXL04_014003

Reference: OH-1004 Chr: Chr03 Coordinates: 40403403-40405402 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

714 bp · LXL04_014003|LXL04_014003|OH1004|cDNA

ATGGCGGGATCTTTGTCGCTTCTCCGGCGATTCTATCTCGTTGCTTACAATTGGATTGTCTTCGCCGGATGGCAATTCATATATCTTATCGTCATTTCTCTGTCTTCTCAATGTTTTAGGTTTCAAGTATTGTTCTTGGCTCTGAAAACTCTAAAGGAATCAGGCCACGAACACGTTTACAGTAACATCGAAAAACCACTCTTGTTAGCTCAATCGGCTGCCTTTTTAGAGATACTACATGGTATTGTAGGCTTGGTAAG...

CDS

Download CDS FASTA

714 bp · LXL04_014003|LXL04_014003|OH1004|CDS

ATGGCGGGATCTTTGTCGCTTCTCCGGCGATTCTATCTCGTTGCTTACAATTGGATTGTCTTCGCCGGATGGCAATTCATATATCTTATCGTCATTTCTCTGTCTTCTCAATGTTTTAGGTTTCAAGTATTGTTCTTGGCTCTGAAAACTCTAAAGGAATCAGGCCACGAACACGTTTACAGTAACATCGAAAAACCACTCTTGTTAGCTCAATCGGCTGCCTTTTTAGAGATACTACATGGTATTGTAGGCTTGGTAAG...

Protein

Download Protein FASTA

237 aa · LXL04_014003|LXL04_014003|OH1004|PROTEIN

MAGSLSLLRRFYLVAYNWIVFAGWQFIYLIVISLSSQCFRFQVLFLALKTLKESGHEHVYSNIEKPLLLAQSAAFLEILHGIVGLVRSPISATLPQISSRLYVVWGILYSFPEVQTHPIVSSLVISWCITEIIRYSFFGTKEAFGSTPYWMLWLRYSTFLVLYPTGIASEIGMIYNALPYMKESELYSIRMPNKWNFSFDYFYFAFVVLAIYVPGIPHLYGYMLAQRKKTLAKSKKA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014003`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014003

Location Chr03:40403403-40405402 (-)

Description Similar to PAS2: Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10480`	Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle.	Pasticcino2 is a protein tyrosine phosphatase-like involved in cell proliferation and differentiation in Arabidopsis.2002 · DOI: 10.1046/j.1365-313x.2002.01456.x Hormonal control of cell proliferation requires PASTICCINO genes.2003 · DOI: 10.1104/pp.102.019026 Arabidopsis PASTICCINO2 is an antiphosphatase involved in regulation of cyclin-dependent kinase A.2006 · DOI: 10.1105/tpc.105.040485 The very-long-chain hydroxy fatty acyl-CoA dehydratase PASTICCINO2 is essential and limiting for plant development.2008 · DOI: 10.1073/pnas.0805089105 Very-long-chain fatty acids are required for cell plate formation during cytokinesis in Arabidopsis thaliana.2011 · DOI: 10.1242/jcs.074575

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0271200`	Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle.	No verified direct reference in this release
`Os01g0150200`	Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014003 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0030148 sphingolipid biosynthetic process Biological Process

GO:0030154 cell differentiation Biological Process

GO:0030497 fatty acid elongation Biological Process

GO:0035338 long-chain fatty-acyl-CoA biosynthetic process Biological Process

GO:0042761 very long-chain fatty acid biosynthetic process Biological Process

GO:0048640 negative regulation of developmental growth Biological Process

GO:0050732 negative regulation of peptidyl-tyrosine phosphorylation Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT5G10480

bta:613886

dosa:Os01g0150200

dosa:Os04g0271200

hsa:201562

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.817

Rank 1 · LXL04_014003 · OH-1004

Nucleus0.088

Rank 2 · LXL04_014003 · OH-1004

Cytoplasm0.070

Rank 3 · LXL04_014003 · OH-1004

Mitochondrion0.055

Rank 4 · LXL04_014003 · OH-1004

Golgi apparatus0.054

Rank 5 · LXL04_014003 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04387.20PTPLA71-232 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014003	`PF04387.20`	PTPLA	71	232	8.9e-62	208.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZB2`	Arabidopsis thaliana	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2	66.949%	Swiss-Prot	strong database homology
`Q7XSZ4`	Oryza sativa subsp. japonica	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2A	66.079%	Swiss-Prot	strong database homology
`Q5ZEJ0`	Oryza sativa subsp. japonica	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2B	63.877%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card