LXL04_013929 | RubberDandelionOmics

Gene overview

LXL04_013929

Reference: OH-1004 Chr: Chr03 Coordinates: 38294966-38299695 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2295 bp · LXL04_013929|LXL04_013929|OH1004|cDNA

ATggcatcttcttcttcttctaacgccatttttttgggttttttgTTGTACCTTTCAATCTTCGCTTCTGCTAAGGTGTATGTCGTGTACATGGGTAGCTCCGATAATGAACACCCACATCAGATTTTGACCCGAAACCATCAAATCCTTTCTTCTGTTCATAGCGGAAGTGTTGAAGATGGAAAGGCTGCTCACTTGTACAGTTATAAACATGGGTTTAAAGGGTTTGCAGCTAAGTTAACTGAAGATCAAGCCCTTCA...

CDS

Download CDS FASTA

2295 bp · LXL04_013929|LXL04_013929|OH1004|CDS

ATGGCATCTTCTTCTTCTTCTAACGCCATTTTTTTGGGTTTTTTGTTGTACCTTTCAATCTTCGCTTCTGCTAAGGTGTATGTCGTGTACATGGGTAGCTCCGATAATGAACACCCACATCAGATTTTGACCCGAAACCATCAAATCCTTTCTTCTGTTCATAGCGGAAGTGTTGAAGATGGAAAGGCTGCTCACTTGTACAGTTATAAACATGGGTTTAAAGGGTTTGCAGCTAAGTTAACTGAAGATCAAGCCCTTCA...

Protein

Download Protein FASTA

764 aa · LXL04_013929|LXL04_013929|OH1004|PROTEIN

MASSSSSNAIFLGFLLYLSIFASAKVYVVYMGSSDNEHPHQILTRNHQILSSVHSGSVEDGKAAHLYSYKHGFKGFAAKLTEDQALQISKMEGVVSVFENRKRKLHTTHSWDFIGLGEEETMEIPGFSTKDQVDVIIGFIDTGIWPESPSFSDSDMPPVPSKWKGICQSGEAFNATNCNRKLIGARYYHSGYESEEQHAKLNQNPQAIVDDPKKKLSFRSPRDSNGHGTHTASTAAGRYVAMNYNGLASGGARGGAPMAR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013929`
TK1151 ID	TkA02G463390
OH-1004 ID	LXL04_013929
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013929

Location Chr03:38294966-38299695 (+)

Description Similar to SbtS: Subtilisin-like serine-protease S

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45650`	Subtilisin-like protease SBT5.6.	No verified direct reference in this release
`At4g34980`	Subtilisin-like protease SBT1.6.	No verified direct reference in this release
`At2g04160`	Serine protease.	No verified direct reference in this release
`At5g59810`	Serine protease.	Overexpression of an Arabidopsis gene encoding a subtilase (AtSBT5.4) produces a clavata-like phenotype.2009 · DOI: 10.1007/s00425-009-0976-5

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013929 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009609 response to symbiotic bacterium Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009733 response to auxin Biological Process

GO:0009827 plant-type cell wall modification Biological Process

GO:0010074 maintenance of meristem identity Biological Process

GO:0010102 lateral root morphogenesis Biological Process

GO:0036377 arbuscular mycorrhizal association Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G04160

ath:AT4G34980

ath:AT5G45650

ath:AT5G59810

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.721

Rank 1 · LXL04_013929 · OH-1004

Lysosome / Vacuole0.085

Rank 2 · LXL04_013929 · OH-1004

Cell membrane0.082

Rank 3 · LXL04_013929 · OH-1004

Cytoplasm0.065

Rank 4 · LXL04_013929 · OH-1004

Endoplasmic reticulum0.048

Rank 5 · LXL04_013929 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05922.22Inhibitor_I926-106 aa

PF00082.28Peptidase_S8134-591 aa

PF02225.28PA409-474 aa

PF17766.8fn3_6666-761 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013929	`PF05922.22`	Inhibitor_I9	26	106	2.5e-19	70.4
LXL04_013929	`PF00082.28`	Peptidase_S8	134	591	1.6e-48	166.2
LXL04_013929	`PF02225.28`	PA	409	474	5.4e-06	27.2
LXL04_013929	`PF17766.8`	fn3_6	666	761	8.3e-26	90.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FK76`	Arabidopsis thaliana	Subtilisin-like protease SBT5.6	41.980%	Swiss-Prot	moderate database homology
`O49607`	Arabidopsis thaliana	Subtilisin-like protease SBT1.6	42.025%	Swiss-Prot	moderate database homology
`Q9ZSP5`	Arabidopsis thaliana	Subtilisin-like protease SBT5.3	42.208%	Swiss-Prot	moderate database homology
`F4JXC5`	Arabidopsis thaliana	Subtilisin-like protease SBT5.4	41.795%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card