LXL04_013858 | RubberDandelionOmics

Gene overview

LXL04_013858

Reference: OH-1004 Chr: Chr03 Coordinates: 37034998-37037603 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1002 bp · LXL04_013858|LXL04_013858|OH1004|cDNA

ATGAGTTTTCTCGTTACCTCCGAAGACCCATCGGATCGTCTATCTGACCGATGTTGCAACTTGAGCCCCAGTCTGTCCGATCCCGCTAAAAGATCTACATTATGTATGCAACTGATGCTGGTGATGCTTCATCTTGTTTACATCGGTTTTCTTCTCATATTCGACAGTGAATTCATGGATAGTTTAAAAAGACATCATTGGTACACAATTATCTATCTACTGTTCTTTATGGCTACCATAGCTCAGTATCTTTTCACATC...

CDS

Download CDS FASTA

1002 bp · LXL04_013858|LXL04_013858|OH1004|CDS

ATGAGTTTTCTCGTTACCTCCGAAGACCCATCGGATCGTCTATCTGACCGATGTTGCAACTTGAGCCCCAGTCTGTCCGATCCCGCTAAAAGATCTACATTATGTATGCAACTGATGCTGGTGATGCTTCATCTTGTTTACATCGGTTTTCTTCTCATATTCGACAGTGAATTCATGGATAGTTTAAAAAGACATCATTGGTACACAATTATCTATCTACTGTTCTTTATGGCTACCATAGCTCAGTATCTTTTCACATC...

Protein

Download Protein FASTA

333 aa · LXL04_013858|LXL04_013858|OH1004|PROTEIN

MSFLVTSEDPSDRLSDRCCNLSPSLSDPAKRSTLCMQLMLVMLHLVYIGFLLIFDSEFMDSLKRHHWYTIIYLLFFMATIAQYLFTSGSSPGYVLDAMREFSRAEALLRTSEASKRPAPSKNDSVIVTLDGNQRGENILGNNRMNWTKMVMDMYPNGTSVRTCTCSFCNVVQPPRTKHCHDCEKCILQFDHHCVWLGTCIGQRNHRRFWWYIFEEFVLCIWTGIWYMQYLNDHIKESWWNVVFVIIMLAILAVSMMFLFL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013858`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013858

Location Chr03:37034998-37037603 (+)

Description Similar to PAT10: Protein S-acyltransferase 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51390`	S-acyltransferase involved in protein lipid modification.	Protein S-ACYL Transferase10 is critical for development and salt tolerance in Arabidopsis.2013 · DOI: 10.1105/tpc.112.108829
`At3g26935`	Palmitoyl acyltransferase.	No verified direct reference in this release
`At4g24630`	S-acyltransferase involved in protein lipid modification.	No verified direct reference in this release
`At3g56930`	Palmitoyl acyltransferase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013858 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006612 protein targeting to membrane Biological Process

GO:0009651 response to salt stress Biological Process

GO:0018230 peptidyl-L-cysteine S-palmitoylation Biological Process

GO:0048767 root hair elongation Biological Process

GO:0099402 plant organ development Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT3G26935

ath:AT3G51390

ath:AT3G56930

ath:AT4G24630

dre:100332332

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.335

Rank 1 · LXL04_013858 · OH-1004

Endoplasmic reticulum0.279

Rank 2 · LXL04_013858 · OH-1004

Cytoplasm0.255

Rank 3 · LXL04_013858 · OH-1004

Cell membrane0.197

Rank 4 · LXL04_013858 · OH-1004

Lysosome / Vacuole0.153

Rank 5 · LXL04_013858 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01529.26DHHC162-280 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013858	`PF01529.26`	DHHC	162	280	1.8e-33	116.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XA86`	Arabidopsis thaliana	Protein S-acyltransferase 10	54.294%	Swiss-Prot	strong database homology
`Q0WQK2`	Arabidopsis thaliana	Probable protein S-acyltransferase 7	28.859%	Swiss-Prot	weak database homology
`Q9SB58`	Arabidopsis thaliana	Protein S-acyltransferase 8	33.193%	Swiss-Prot	moderate database homology
`Q9M1K5`	Arabidopsis thaliana	Probable protein S-acyltransferase 4	37.195%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card