LXL04_013828 | RubberDandelionOmics

Gene overview

LXL04_013828

Reference: OH-1004 Chr: Chr03 Coordinates: 36583870-36585862 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

594 bp · LXL04_013828|LXL04_013828|OH1004|cDNA

ATGAGTGCATCGAGGTTCATAAAGTGCGTCACCGTCGGCGATGGGGCTGTGGGAAAGACGTGTCTCTTGATTTCATATACCAGCAACACTTTCCCTACGGATTATGTCCCGACTGTATTTGATAATTTCAGTGCGAATGTGGTTGTGAATGGCAGCACAGTTAATCTAGGCTTGTGGGACACTGCTGGACAGGAGGATTATAACAGATTAAGACCGTTGAGTTATCGTGGGGCTGATGTTTTCATTTTGGCCTTTTCTCT...

CDS

Download CDS FASTA

594 bp · LXL04_013828|LXL04_013828|OH1004|CDS

ATGAGTGCATCGAGGTTCATAAAGTGCGTCACCGTCGGCGATGGGGCTGTGGGAAAGACGTGTCTCTTGATTTCATATACCAGCAACACTTTCCCTACGGATTATGTCCCGACTGTATTTGATAATTTCAGTGCGAATGTGGTTGTGAATGGCAGCACAGTTAATCTAGGCTTGTGGGACACTGCTGGACAGGAGGATTATAACAGATTAAGACCGTTGAGTTATCGTGGGGCTGATGTTTTCATTTTGGCCTTTTCTCT...

Protein

Download Protein FASTA

197 aa · LXL04_013828|LXL04_013828|OH1004|PROTEIN

MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFVDHPNATPITSAQGAELKDTIGAPEYIECSSKTQLNVKQVFDAAIKVVLAPPKAKKKKGKGQKACSIL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013828`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013828

Location Chr03:36583870-36585862 (+)

Description Similar to RHO1: Rac-like GTP-binding protein RHO1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51300`	May be involved in cell polarity control during the actin-dependent tip growth of pollen tubes.	No verified direct reference in this release
`At2g17800`	Inactive GDP-bound Rho GTPases reside in the cytosol, are found in a complex with Rho GDP-dissociation inhibitors (Rho GDIs), and are released from the GDI protein in order to translocate to membranes upon activation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0120800`	Inactive GDP-bound Rho GTPases reside in the cytosol, are found in a complex with Rho GDP-dissociation inhibitors (Rho GDIs), and are released from the GDI protein in order to translocate to membranes upon activation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013828 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007015 actin filament organization Biological Process

GO:0007163 establishment or maintenance of cell polarity Biological Process

GO:0007165 signal transduction Biological Process

GO:0007264 small GTPase-mediated signal transduction Biological Process

GO:0008360 regulation of cell shape Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0017157 regulation of exocytosis Biological Process

GO:0030833 regulation of actin filament polymerization Biological Process

GO:0030834 regulation of actin filament depolymerization Biological Process

GO:0030865 cortical cytoskeleton organization Biological Process

KEGG gene cross-reference

ath:AT2G17800

ath:AT3G51300

bvg:104895157

dosa:Os02g0120800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.565

Rank 1 · LXL04_013828 · OH-1004

Cytoplasm0.410

Rank 2 · LXL04_013828 · OH-1004

Nucleus0.127

Rank 3 · LXL04_013828 · OH-1004

Golgi apparatus0.114

Rank 4 · LXL04_013828 · OH-1004

Endoplasmic reticulum0.058

Rank 5 · LXL04_013828 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00071.29Ras8-177 aa

PF08477.20Roc8-121 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013828	`PF00071.29`	Ras	8	177	1.8e-49	168.2
LXL04_013828	`PF08477.20`	Roc	8	121	4.9e-24	85.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P92978`	Arabidopsis thaliana	Rac-like GTP-binding protein ARAC11	91.371%	Swiss-Prot	strong database homology
`Q38902`	Arabidopsis thaliana	Rac-like GTP-binding protein ARAC1	91.878%	Swiss-Prot	strong database homology
`Q6ZHA3`	Oryza sativa subsp. japonica	Rac-like GTP-binding protein 6	89.848%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card