LXL04_013774 | RubberDandelionOmics

Gene overview

LXL04_013774

Reference: OH-1004 Chr: Chr03 Coordinates: 35766638-35767884 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

471 bp · LXL04_013774|LXL04_013774|OH1004|cDNA

ATGAAAAACCAAGACCGAGAGAATCGAGACCAAAGGAGACTAGGAGAGAGATCACAGAATGAAAACGGAGCCGAGAGGAAGGGGCGGGAACTGGTAATAGGCGTCGGCTGTGGAGTCTCATCTCCCTCACTTCAATACCTCCCAATTGAAGCTTTGATTGGGCCTTTTGGCACACTCTTTAATTCTGAGTTCTATATTTACCAAAAAGGACTATTAGTCGAATTCTATGCACCATGGTGTGGTCATTACAAAGAGTCTTG...

CDS

Download CDS FASTA

471 bp · LXL04_013774|LXL04_013774|OH1004|CDS

ATGAAAAACCAAGACCGAGAGAATCGAGACCAAAGGAGACTAGGAGAGAGATCACAGAATGAAAACGGAGCCGAGAGGAAGGGGCGGGAACTGGTAATAGGCGTCGGCTGTGGAGTCTCATCTCCCTCACTTCAATACCTCCCAATTGAAGCTTTGATTGGGCCTTTTGGCACACTCTTTAATTCTGAGTTCTATATTTACCAAAAAGGACTATTAGTCGAATTCTATGCACCATGGTGTGGTCATTACAAAGAGTCTTG...

Protein

Download Protein FASTA

156 aa · LXL04_013774|LXL04_013774|OH1004|PROTEIN

MKNQDRENRDQRRLGERSQNENGAERKGRELVIGVGCGVSSPSLQYLPIEALIGPFGTLFNSEFYIYQKGLLVEFYAPWCGHYKESCPSAFKNEEDVVIVVLDVDSHKDLVEKYGVSGFPTIKLFPKNNKDGEDYDGGRDIDSFPSFINEKCGTSM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013774`
TK1151 ID	TkA02G472800
OH-1004 ID	LXL04_013774
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013774

Location Chr03:35766638-35767884 (-)

Description Similar to PDIL2-1: Protein disulfide-isomerase like 2-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47470`	Protein disulfide isomerase that may be required for proper pollen development, ovule fertilization and embryo development.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0156300`	Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds.	No verified direct reference in this release
`Os01g0339900`	Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013774 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0034976 response to endoplasmic reticulum stress Biological Process

GO:0048868 pollen tube development Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT2G47470

dosa:Os01g0339900

dosa:Os05g0156300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.312

Rank 1 · LXL04_013774 · OH-1004

Extracellular0.158

Rank 2 · LXL04_013774 · OH-1004

Nucleus0.150

Rank 3 · LXL04_013774 · OH-1004

Mitochondrion0.140

Rank 4 · LXL04_013774 · OH-1004

Endoplasmic reticulum0.131

Rank 5 · LXL04_013774 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00085.27Thioredoxin62-149 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013774	`PF00085.27`	Thioredoxin	62	149	3.8e-17	62.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22263`	Arabidopsis thaliana	Protein disulfide-isomerase like 2-1	66.667%	Swiss-Prot	moderate database homology
`Q75M08`	Oryza sativa subsp. japonica	Protein disulfide isomerase-like 2-1	60.784%	Swiss-Prot	moderate database homology
`Q942L2`	Oryza sativa subsp. japonica	Protein disulfide isomerase-like 2-2	60.784%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card