LXL04_013766 | RubberDandelionOmics

Gene overview

LXL04_013766

Reference: OH-1004 Chr: Chr03 Coordinates: 35658415-35669129 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1743 bp · LXL04_013766|LXL04_013766|OH1004|cDNA

ATGGTTGAAGAAAGGTACGCCACAGGAGTCACGAAGTGTACGCATTCACAGACAGGAAGAAAGGGGAACAAGAACGATAGAAGACAGATAACCACAATCGAAATTAAAGAAATTCCGGATACAGATAGGGCTGAATCGAGTACCGGAAATTTCGCAAGCATGTGGTGGGCAGACCTAAAAGCAGCAATAGGGCAATGGATTAACGTCGAGGGACTGCTGTTTTCGGTATCGGTGATTACTAGAAACAAGAAATGGGTGAT...

CDS

Download CDS FASTA

1743 bp · LXL04_013766|LXL04_013766|OH1004|CDS

ATGGTTGAAGAAAGGTACGCCACAGGAGTCACGAAGTGTACGCATTCACAGACAGGAAGAAAGGGGAACAAGAACGATAGAAGACAGATAACCACAATCGAAATTAAAGAAATTCCGGATACAGATAGGGCTGAATCGAGTACCGGAAATTTCGCAAGCATGTGGTGGGCAGACCTAAAAGCAGCAATAGGGCAATGGATTAACGTCGAGGGACTGCTGTTTTCGGTATCGGTGATTACTAGAAACAAGAAATGGGTGAT...

Protein

Download Protein FASTA

580 aa · LXL04_013766|LXL04_013766|OH1004|PROTEIN

MVEERYATGVTKCTHSQTGRKGNKNDRRQITTIEIKEIPDTDRAESSTGNFASMWWADLKAAIGQWINVEGLLFSVSVITRNKKWVMPHLSVRDIRYIDWAALRRKGYEGVVFDKDNTLTAPYSLALWGPLAASVESYRSVFGNNIVVFSNSAGLEEYDPDGRKARALEYVIGIRVIRHILTNVFVYVTLEMKKPAGSAEEIEKHFGCDSSKLIMVGDRPFTDIVYGNGIFVRCDNDRDGALSDAELKDFQVKCFNAPLQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013766`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013766

Location Chr03:35658415-35669129 (+)

Description Similar to MIRO1: Mitochondrial Rho GTPase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g27540`	Mitochondrial GTPase required to maintain proper development, morphology and intracellular distribution of mitochondria, which in turn are essential for the progress of embryonic cell division, development of haploid male and female gametes, and pollen tube growth.	EMB2473/MIRO1, an Arabidopsis Miro GTPase, is required for embryogenesis and influences mitochondrial morphology in pollen.2008 · DOI: 10.1105/tpc.107.055756 MIRO1 influences the morphology and intracellular distribution of mitochondria during embryonic cell division in Arabidopsis.2011 · DOI: 10.1007/s00299-010-0926-5 Arabidopsis thaliana MIRO1 and MIRO2 GTPases are unequally redundant in pollen tube growth and fusion of polar nuclei during female gametogenesis.2011 · DOI: 10.1371/journal.pone.0018530
`At3g63150`	Calcium-binding mitochondrial GTPase involved in calcium signaling during salt stress response.	Arabidopsis thaliana MIRO1 and MIRO2 GTPases are unequally redundant in pollen tube growth and fusion of polar nuclei during female gametogenesis.2011 · DOI: 10.1371/journal.pone.0018530
`At3g05310`	Mitochondrial GTPase that may be involved in mitochondrion development.	No verified direct reference in this release
`At3g58830`	Phosphatidylglycerophosphate (PGP) phosphatase involved in the biosynthesis of phosphatidylglycerol (PG), a phosphoglycerolipid predominantly present in chloroplastic thylakoid membranes and which has important photosynthetic function; seems to use PGP 34:3, PGP 34:2 and PGP 34:1 as substrates.	Arabidopsis phosphatidylglycerophosphate phosphatase 1 involved in phosphatidylglycerol biosynthesis and photosynthetic function.2016 · DOI: 10.1111/tpj.13311 Identification and characterization of a plastidial phosphatidylglycerophosphate phosphatase in Arabidopsis thaliana.2017 · DOI: 10.1111/tpj.13378 Phosphatidylglycerophosphate phosphatase is required for root growth in Arabidopsis.2018 · DOI: 10.1016/j.bbalip.2018.02.007

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013766 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006655 phosphatidylglycerol biosynthetic process Biological Process

GO:0007005 mitochondrion organization Biological Process

GO:0008610 lipid biosynthetic process Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010027 thylakoid membrane organization Biological Process

GO:0015979 photosynthesis Biological Process

GO:0019725 cellular homeostasis Biological Process

GO:0046486 glycerolipid metabolic process Biological Process

GO:0046839 phospholipid dephosphorylation Biological Process

KEGG gene cross-reference

ath:AT3G05310

ath:AT3G58830

ath:AT3G63150

ath:AT5G27540

dre:327143

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.237

Rank 1 · LXL04_013766 · OH-1004

Cytoplasm0.233

Rank 2 · LXL04_013766 · OH-1004

Endoplasmic reticulum0.182

Rank 3 · LXL04_013766 · OH-1004

Nucleus0.149

Rank 4 · LXL04_013766 · OH-1004

Plastid0.135

Rank 5 · LXL04_013766 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09419.17PGP_phosphatase74-228 aa

PF08356.19EF_assoc_2258-342 aa

PF08355.18EF_assoc_1378-436 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013766	`PF09419.17`	PGP_phosphatase	74	228	3.7e-35	121.7
LXL04_013766	`PF08356.19`	EF_assoc_2	258	342	9.4e-30	103.2
LXL04_013766	`PF08355.18`	EF_assoc_1	378	436	1.2e-19	70.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXF8`	Arabidopsis thaliana	Mitochondrial Rho GTPase 1	56.970%	Swiss-Prot	moderate database homology
`F4J0W4`	Arabidopsis thaliana	Mitochondrial Rho GTPase 2	56.911%	Swiss-Prot	weak database homology
`Q9MA88`	Arabidopsis thaliana	Mitochondrial Rho GTPase 3	53.012%	Swiss-Prot	weak database homology
`Q9LXR9`	Arabidopsis thaliana	Phosphatidylglycerophosphate phosphatase 1, chloroplastic/mitochondrial	65.537%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card