LXL04_013726 | RubberDandelionOmics

Gene overview

LXL04_013726

Reference: OH-1004 Chr: Chr03 Coordinates: 34874750-34876718 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1488 bp · LXL04_013726|LXL04_013726|OH1004|cDNA

ATGAAACCCAATTCCTTTTCACTTCGCCTTGTATTATTTTCATACATTTCATTACTTTCCTTTCTCCATTTCCCCCATGCAATTACCGCAACAGCTTTACGTCAAGGTGGTACGCCACCAGTAAGTGAGGGGCCCACGGTGAGGAAAGAAGAAAGGTGGCCGTTAGAGGTGTCGGAGTTCGGTGAAGTCTCGGCGGTTAAAATTAGCGACGGAGAAAATGGGTGCCACCACCTCCATTTTATTACCATGGATCCTAACTC...

CDS

Download CDS FASTA

1488 bp · LXL04_013726|LXL04_013726|OH1004|CDS

ATGAAACCCAATTCCTTTTCACTTCGCCTTGTATTATTTTCATACATTTCATTACTTTCCTTTCTCCATTTCCCCCATGCAATTACCGCAACAGCTTTACGTCAAGGTGGTACGCCACCAGTAAGTGAGGGGCCCACGGTGAGGAAAGAAGAAAGGTGGCCGTTAGAGGTGTCGGAGTTCGGTGAAGTCTCGGCGGTTAAAATTAGCGACGGAGAAAATGGGTGCCACCACCTCCATTTTATTACCATGGATCCTAACTC...

Protein

Download Protein FASTA

495 aa · LXL04_013726|LXL04_013726|OH1004|PROTEIN

MKPNSFSLRLVLFSYISLLSFLHFPHAITATALRQGGTPPVSEGPTVRKEERWPLEVSEFGEVSAVKISDGENGCHHLHFITMDPNSFFVPVHLYSQMVFYVNSGSGTLNWINIEEDDDKLQTVKLQKGDVYRLQPQTIFYLQNDIHYNNPQKLEIYAIFSASSYELKNGLFAKAYASIQDLILGFDDRVLRSALRVPEEVIGELRAGTQSLIVQGQPETNTSMWEVGSRAMIRAFLGTKNINGVFEVENGKKKAYNILK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013726`
TK1151 ID	TkA02G475030
OH-1004 ID	LXL04_013726
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 54.949 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013726

Location Chr03:34874750-34876718 (+)

Description Similar to At2g18540: Vicilin-like seed storage protein At2g18540

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g18540`	Seed storage protein.	No verified direct reference in this release
`At4g36700`	Seed storage protein.	No verified direct reference in this release
`At2g28490`	Seed storage protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013726 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010431 seed maturation Biological Process

GO:0034214 protein hexamerization Biological Process

GO:0070207 protein homotrimerization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0043245 extraorganismal space Cellular Component

GO:0005507 copper ion binding Molecular Function

GO:0045735 nutrient reservoir activity Molecular Function

KEGG gene cross-reference

ath:AT2G18540

ath:AT2G28490

ath:AT4G36700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.411

Rank 1 · LXL04_013726 · OH-1004

Endoplasmic reticulum0.217

Rank 2 · LXL04_013726 · OH-1004

Extracellular0.202

Rank 3 · LXL04_013726 · OH-1004

Cytoplasm0.141

Rank 4 · LXL04_013726 · OH-1004

Cell membrane0.107

Rank 5 · LXL04_013726 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00190.29Cupin_1256-409 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013726	`PF00190.29`	Cupin_1	256	409	4.5e-34	117.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IQK5`	Arabidopsis thaliana	Vicilin-like seed storage protein At2g18540	44.363%	Swiss-Prot	moderate database homology
`F4JQG6`	Arabidopsis thaliana	Vicilin-like seed storage protein At4g36700	41.872%	Swiss-Prot	moderate database homology
`Q9SK09`	Arabidopsis thaliana	Vicilin-like seed storage protein At2g28490	29.803%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card