LXL04_013111 | RubberDandelionOmics

Gene overview

LXL04_013111

Reference: OH-1004 Chr: Chr03 Coordinates: 24272297-24274380 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1992 bp · LXL04_013111|LXL04_013111|OH1004|cDNA

ATGGCGTCAATTCTTCGGTTCCGGAAGCTGTGTTTCATTGAGCCAACAACGAAAACCTACGAATCATTCGAAACCCCGATAGAAGAAAAAATTCAAGCAATTAAAGAACAAGAGATCGATAAGAACAAGAAGAAAAGGCCGGTAAAGGCAAGAGGATGGCGGTGTGTTGATTCATGTTGTTGGTTCATTGGTTGCATGTGTACTACTTGGTGGCTACTCTTGTTCCTCTACCATTGTTTACCTGCTGGGTTTAAAGGTCC...

CDS

Download CDS FASTA

1992 bp · LXL04_013111|LXL04_013111|OH1004|CDS

ATGGCGTCAATTCTTCGGTTCCGGAAGCTGTGTTTCATTGAGCCAACAACGAAAACCTACGAATCATTCGAAACCCCGATAGAAGAAAAAATTCAAGCAATTAAAGAACAAGAGATCGATAAGAACAAGAAGAAAAGGCCGGTAAAGGCAAGAGGATGGCGGTGTGTTGATTCATGTTGTTGGTTCATTGGTTGCATGTGTACTACTTGGTGGCTACTCTTGTTCCTCTACCATTGTTTACCTGCTGGGTTTAAAGGTCC...

Protein

Download Protein FASTA

663 aa · LXL04_013111|LXL04_013111|OH1004|PROTEIN

MASILRFRKLCFIEPTTKTYESFETPIEEKIQAIKEQEIDKNKKKRPVKARGWRCVDSCCWFIGCMCTTWWLLLFLYHCLPAGFKGPESPGVRLKNEGLTPLHPVVLVPGIVTGGLELWEGRPCSHGLFRKRLWGGSFTEVLKRPLCWLEHLSLDDETGLDPPGIRVRPVTGLVAADYFAPGYFVWAVLIENLAKIGYEGKNMYMAAYDWRLSFQNTEVRDQAFSRLKINIELMYVTNGNKKVVVVPHSMGAIYFLHFMK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013111`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013111

Location Chr03:24272297-24274380 (-)

Description Similar to PDAT2: Putative phospholipid:diacylglycerol acyltransferase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g44830`	Putative phospholipid:diacylglycerol acyltransferase 2.	No verified direct reference in this release
`At5g13640`	Triacylglycerol formation by an acyl-CoA independent pathway.	Cloning and functional characterization of a phospholipid:diacylglycerol acyltransferase from Arabidopsis.2004 · DOI: 10.1104/pp.104.044354 DGAT1 and PDAT1 acyltransferases have overlapping functions in Arabidopsis triacylglycerol biosynthesis and are essential for normal pollen and seed development.2009 · DOI: 10.1105/tpc.109.071795 DGAT1, DGAT2 and PDAT expression in seeds and other tissues of epoxy and hydroxy fatty acid accumulating plants.2010 · DOI: 10.1007/s11745-010-3385-4
`At1g04010`	Involved in lipid catabolism.	Cellular sterol ester synthesis in plants is performed by an enzyme (phospholipid:sterol acyltransferase) different from the yeast and mammalian acyl-CoA:sterol acyltransferases.2005 · DOI: 10.1074/jbc.m504459200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013111 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006071 glycerol metabolic process Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0006672 ceramide metabolic process Biological Process

GO:0019432 triglyceride biosynthetic process Biological Process

GO:0019915 lipid storage Biological Process

GO:0046339 diacylglycerol metabolic process Biological Process

GO:0055091 phospholipid homeostasis Biological Process

GO:0140042 lipid droplet formation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005637 nuclear inner membrane Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT3G44830

ath:AT5G13640

sce:YNR008W

spo:2541187

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.342

Rank 1 · LXL04_013111 · OH-1004

Golgi apparatus0.305

Rank 2 · LXL04_013111 · OH-1004

Lysosome / Vacuole0.134

Rank 3 · LXL04_013111 · OH-1004

Cytoplasm0.107

Rank 4 · LXL04_013111 · OH-1004

Cell membrane0.083

Rank 5 · LXL04_013111 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02450.22LCAT129-424 aa

PF02450.22LCAT454-623 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013111	`PF02450.22`	LCAT	129	424	6.1e-71	240.4
LXL04_013111	`PF02450.22`	LCAT	454	623	6.1e-71	240.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FYC7`	Arabidopsis thaliana	Putative phospholipid:diacylglycerol acyltransferase 2	65.198%	Swiss-Prot	strong database homology
`Q9FNA9`	Arabidopsis thaliana	Phospholipid:diacylglycerol acyltransferase 1	59.970%	Swiss-Prot	strong database homology
`Q4VCM1`	Arabidopsis thaliana	Phospholipid--sterol O-acyltransferase	24.437%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card