Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1470 bp · LXL04_013105|LXL04_013105|OH1004|cDNA
ATGGGAAAACCTCATTTTGTTTCTATACTCCTTATTATTTCAGTAGTATGCATTCTTCTACCACACTTTCATGGAGGATTGGCCATTGCTGCTGGCACCAAAGATGGATCAGAacaatggggttatgttcaaGTCAGACCCGGAGCCCACATGTTCTGGTGGTACTACAAAAGTCCTTATAGAATTAGTGATCCAAACAAGCCATGGCCAATTGTTCTTTGGTTACAGGGTGGACCTgGTTCTTCTGGAGTTGGAATTGG...
1470 bp · LXL04_013105|LXL04_013105|OH1004|CDS
ATGGGAAAACCTCATTTTGTTTCTATACTCCTTATTATTTCAGTAGTATGCATTCTTCTACCACACTTTCATGGAGGATTGGCCATTGCTGCTGGCACCAAAGATGGATCAGAACAATGGGGTTATGTTCAAGTCAGACCCGGAGCCCACATGTTCTGGTGGTACTACAAAAGTCCTTATAGAATTAGTGATCCAAACAAGCCATGGCCAATTGTTCTTTGGTTACAGGGTGGACCTGGTTCTTCTGGAGTTGGAATTGG...
Protein
Download Protein FASTA489 aa · LXL04_013105|LXL04_013105|OH1004|PROTEIN
MGKPHFVSILLIISVVCILLPHFHGGLAIAAGTKDGSEQWGYVQVRPGAHMFWWYYKSPYRISDPNKPWPIVLWLQGGPGSSGVGIGNFQEIGPLDSFLKQRNSTWLRKADLLFVDNPVGTGYSFVEDKELLVKTDEEAGRDLTTLLIKLFNRNKSLQKSPLYIVAESYGGKYAVTLGLSALKAIKAKKLKLTLGGIALGDTWISPEDFVVSWGPLLRDLSRINNSGFKKSERFICASHFLTTLCVCVFLSDKPFSGYSL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_013105 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_013105 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:24182255-24184950 (+) | |||||||||
| Description | Similar to SCPL51: Serine carboxypeptidase-like 51 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006508 proteolysis Biological Process GO:0042573 retinoic acid metabolic process Biological Process GO:0045776 negative regulation of blood pressure Biological Process GO:0097746 blood vessel diameter maintenance Biological Process GO:0005576 extracellular region Cellular Component GO:0005773 vacuole Cellular Component GO:0048471 perinuclear region of cytoplasm Cellular Component GO:0070062 extracellular exosome Cellular Component GO:0004185 serine-type carboxypeptidase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT2G27920 ath:AT3G45010 hsa:59342 mmu:74617 rno:114861 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00450.29Peptidase_S1035-482 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_013105 | PF00450.29 | Peptidase_S10 | 35 | 482 | 1.2e-79 | 269.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.