LXL04_012988 | RubberDandelionOmics

Gene overview

LXL04_012988

Reference: OH-1004 Chr: Chr03 Coordinates: 21935837-21937458 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1290 bp · LXL04_012988|LXL04_012988|OH1004|cDNA

ATGAATTCGGATCTTCATAATCAACGGCAACAACAACTGGAACAGAAACTTCAGCAGGAGGGGCAGGGGCAACAACCGATGAACTCAGGTTTGACGCGATACAGATCAGCACCGAGTTCGTATTTCTCAAATTTGATCAACACTGGCATGTCTGAAGACGAAGATGTTGACCCATTCTTCAACCCTCGGGCTTCAAGCCCCGAAACGGAACGTATTTTATCGAGATTAATCTCCAGCAATGGACATGGTGATAATTCAGT...

CDS

Download CDS FASTA

1290 bp · LXL04_012988|LXL04_012988|OH1004|CDS

ATGAATTCGGATCTTCATAATCAACGGCAACAACAACTGGAACAGAAACTTCAGCAGGAGGGGCAGGGGCAACAACCGATGAACTCAGGTTTGACGCGATACAGATCAGCACCGAGTTCGTATTTCTCAAATTTGATCAACACTGGCATGTCTGAAGACGAAGATGTTGACCCATTCTTCAACCCTCGGGCTTCAAGCCCCGAAACGGAACGTATTTTATCGAGATTAATCTCCAGCAATGGACATGGTGATAATTCAGT...

Protein

Download Protein FASTA

429 aa · LXL04_012988|LXL04_012988|OH1004|PROTEIN

MNSDLHNQRQQQLEQKLQQEGQGQQPMNSGLTRYRSAPSSYFSNLINTGMSEDEDVDPFFNPRASSPETERILSRLISSNGHGDNSVSHQNQIRGNDPPFMDPTKQERVNFPYHSQQQQQQQMIYQNHQQSDHNHNSTVSGSTSALVNPLATMNPPMNLLRQSSSPAGFFEHINMDNGYSTMRSMDKFRTANVTVPDSAKRFENQIAFSSGLHSSSKPLSLIPEHEPKTMRISGAHNNAGFNQNLPKTTGYVSTFPHGTS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012988`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012988

Location Chr03:21935837-21937458 (-)

Description Similar to BHLH122: Transcription factor bHLH122

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g51140`	Transcription factor bHLH122.	No verified direct reference in this release
`At2g42280`	Transcription factor bHLH130.	No verified direct reference in this release
`At4g09180`	Transcription factor bHLH81.	No verified direct reference in this release
`At1g35460`	Transcription factor bHLH80.	No verified direct reference in this release
`At1g05805`	Transcription factor bHLH128.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012988 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006808 regulation of nitrogen utilization Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010119 regulation of stomatal movement Biological Process

KEGG gene cross-reference

ath:AT1G05805

ath:AT1G35460

ath:AT1G51140

ath:AT2G42280

ath:AT4G09180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.970

Rank 1 · LXL04_012988 · OH-1004

Cytoplasm0.117

Rank 2 · LXL04_012988 · OH-1004

Cell membrane0.021

Rank 3 · LXL04_012988 · OH-1004

Endoplasmic reticulum0.012

Rank 4 · LXL04_012988 · OH-1004

Plastid0.008

Rank 5 · LXL04_012988 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00010.32HLH363-408 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012988	`PF00010.32`	HLH	363	408	8.1e-10	39.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C690`	Arabidopsis thaliana	Transcription factor bHLH122	36.343%	Swiss-Prot	moderate database homology
`Q66GR3`	Arabidopsis thaliana	Transcription factor bHLH130	36.730%	Swiss-Prot	moderate database homology
`Q9M0R0`	Arabidopsis thaliana	Transcription factor bHLH81	64.706%	Swiss-Prot	weak database homology
`Q9C8P8`	Arabidopsis thaliana	Transcription factor bHLH80	67.391%	Swiss-Prot	weak database homology
`Q8H102`	Arabidopsis thaliana	Transcription factor bHLH128	60.185%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card