LXL04_012931 | RubberDandelionOmics

Gene overview

LXL04_012931

Reference: OH-1004 Chr: Chr03 Coordinates: 21079712-21082617 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1999 bp · LXL04_012931|LXL04_012931|OH1004|cDNA

ACAACCTAATCCACGTTCTGTTTACTATAGAAATATCGCCACTGGTTCTTCATCGAGTACACACACTCCCATCTGCAATGGGAGTAAAGAACATGGGGAGATTTTCGGTTTTCTTGATTATAATGATTTGCTGGGCTTCTATGGCCGAAGCAGAGTACTTCAAATACAAAGATCCAAAACAGCCGTTGGGTGCTCGAATCAAAGATTTAATGAAAAGAATGACGGTAGAGGAAAAGGTCGGCCAAATGACCCAAATCGAT...

CDS

Download CDS FASTA

1950 bp · LXL04_012931|LXL04_012931|OH1004|CDS

CTGTTTACTATAGAAATATCGCCACTGGTTCTTCATCGAGTACACACACTCCCATCTGCAATGGGAGTAAAGAACATGGGGAGATTTTCGGTTTTCTTGATTATAATGATTTGCTGGGCTTCTATGGCCGAAGCAGAGTACTTCAAATACAAAGATCCAAAACAGCCGTTGGGTGCTCGAATCAAAGATTTAATGAAAAGAATGACGGTAGAGGAAAAGGTCGGCCAAATGACCCAAATCGATAGAACAGTTGCATCCAA...

Protein

Download Protein FASTA

649 aa · LXL04_012931|LXL04_012931|OH1004|PROTEIN

MFTIEISPLVLHRVHTLPSAMGVKNMGRFSVFLIIMICWASMAEAEYFKYKDPKQPLGARIKDLMKRMTVEEKVGQMTQIDRTVASNEVMKKYLIGSVLSGGGSVPAKQASAEQWVDMVNDFQKGSLSTRLGIPMIYGIDAVHGHNNVYKSTIFPHNVGLGVTRDPVLVKKIGAATALEVRATGIQYAFAPCIAVCRDPRWGRCYESYSEDPKIVKLMTEIIPGLQGDIPAGSRKGVPFVGGQNKIAACAKHYLGDGGTH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012931`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_012931`
Location	Chr03:21079712-21082617 (+)
Description	Similar to BACOVA_02659: Beta-glucosidase BoGH3B (Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012931` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0009251 glucan catabolic process Biological Process GO:0031222 arabinan catabolic process Biological Process GO:0042742 defense response to bacterium Biological Process GO:0045493 xylan catabolic process Biological Process GO:0085030 symbiotic process benefiting host Biological Process GO:2000899 xyloglucan catabolic process Biological Process GO:0005764 lysosome Cellular Component GO:0008422 beta-glucosidase activity Molecular Function GO:0009044 xylan 1,4-beta-xylosidase activity Molecular Function GO:0015926 glucosidase activity Molecular Function GO:0046556 alpha-L-arabinofuranosidase activity Molecular Function
KEGG gene cross-reference	ddi:DDB_G0292810 ecj:JW2120 eco:b2132 ecoc:C3026_11955 stm:STM2166 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.384

Rank 1 · LXL04_012931 · OH-1004

Extracellular0.298

Rank 2 · LXL04_012931 · OH-1004

Cell membrane0.141

Rank 3 · LXL04_012931 · OH-1004

Cytoplasm0.135

Rank 4 · LXL04_012931 · OH-1004

Endoplasmic reticulum0.081

Rank 5 · LXL04_012931 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00933.28Glyco_hydro_369-397 aa

PF01915.28Glyco_hydro_3_C434-642 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012931	`PF00933.28`	Glyco_hydro_3	69	397	1.1e-70	239.3
LXL04_012931	`PF01915.28`	Glyco_hydro_3_C	434	642	1.1e-39	137.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card