LXL04_012387 | RubberDandelionOmics

Gene overview

LXL04_012387

Reference: OH-1004 Chr: Chr03 Coordinates: 11479108-11492735 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

10275 bp · LXL04_012387|LXL04_012387|OH1004|cDNA

ATGGCTCCAAAATTAGCTAACGCTACCACGTCTACTGAAGAAGAAAGTTCCATTCCAGTCACATCGTCTCTTTATGTAGTTAAAGATAGCAATCATGCGATTAGTTTAGATCCAAAGGACTATGCGGAAACCGTCAGAGTGGTTATCGAATTCTTGAACGTTTTCCCCCTTCACGAAGCTTTAACTGCGGTTCCAAAAACCCCTATTTCGCAGGTTCTTATGAAATTAGCTGTTGATTCGTTCGTGAAAAATGATGACAA...

CDS

Download CDS FASTA

10275 bp · LXL04_012387|LXL04_012387|OH1004|CDS

ATGGCTCCAAAATTAGCTAACGCTACCACGTCTACTGAAGAAGAAAGTTCCATTCCAGTCACATCGTCTCTTTATGTAGTTAAAGATAGCAATCATGCGATTAGTTTAGATCCAAAGGACTATGCGGAAACCGTCAGAGTGGTTATCGAATTCTTGAACGTTTTCCCCCTTCACGAAGCTTTAACTGCGGTTCCAAAAACCCCTATTTCGCAGGTTCTTATGAAATTAGCTGTTGATTCGTTCGTGAAAAATGATGACAA...

Protein

Download Protein FASTA

3424 aa · LXL04_012387|LXL04_012387|OH1004|PROTEIN

MAPKLANATTSTEEESSIPVTSSLYVVKDSNHAISLDPKDYAETVRVVIEFLNVFPLHEALTAVPKTPISQVLMKLAVDSFVKNDDNTITVNIQNDMKATITKSMFLNAIRVPENPSNFTICKPTKEEIAQFKQEIGYIHPQKAKNKSDLVKSGCPAVWQVLIHLLLRSLSGKSGGTDSLNLLWTDFIYSIWSNRPNAVDVPQLLWDEFILYTSRRKNQEMPLERFWALTLEAVYKEHKINPTPDDSSLVCTFTNLKGYK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012387`
TK1151 ID	TkA02G443440
OH-1004 ID	LXL04_012387
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	81.400
Protein coverage (%)	TK1151 100.000 / OH-1004 22.313 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012387

Location Chr03:11479108-11492735 (-)

Description Similar to pif1: ATP-dependent DNA helicase PIF1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08020`	Component of the replication protein A complex (RPA) required for DNA recombination, repair and replication.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012387 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0001117 protein-DNA-RNA complex disassembly Biological Process

GO:0006260 DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0006289 nucleotide-excision repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0007004 telomere maintenance via telomerase Biological Process

GO:0010224 response to UV-B Biological Process

GO:0032211 negative regulation of telomere maintenance via telomerase Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0000781 chromosome, telomeric region Cellular Component

KEGG gene cross-reference

ath:AT5G08020

cje:Cj0945c

mmu:208084

xla:734585

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.916

Rank 1 · LXL04_012387 · OH-1004

Cytoplasm0.166

Rank 2 · LXL04_012387 · OH-1004

Mitochondrion0.035

Rank 3 · LXL04_012387 · OH-1004

Cell membrane0.017

Rank 4 · LXL04_012387 · OH-1004

Endoplasmic reticulum0.008

Rank 5 · LXL04_012387 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14214.12Helitron_like_N1707-1891 aa

PF05970.21PIF12359-2581 aa

PF21530.4Pif1_2B_dom2683-2728 aa

PF02721.22DUF2232822-2922 aa

PF08646.17Rep_fac-A_C3087-3188 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012387	`PF14214.12`	Helitron_like_N	1707	1891	1.1e-57	196.1
LXL04_012387	`PF05970.21`	PIF1	2359	2581	7.2e-82	275.0
LXL04_012387	`PF21530.4`	Pif1_2B_dom	2683	2728	1.1e-21	77.0
LXL04_012387	`PF02721.22`	DUF223	2822	2922	6.3e-10	40.0
LXL04_012387	`PF08646.17`	Rep_fac-A_C	3087	3188	2e-10	41.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SD82`	Arabidopsis thaliana	Replication protein A 70 kDa DNA-binding subunit B	24.074%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card