LXL04_012370 | RubberDandelionOmics

Gene overview

LXL04_012370

Reference: OH-1004 Chr: Chr03 Coordinates: 11195824-11197971 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1806 bp · LXL04_012370|LXL04_012370|OH1004|cDNA

ATGGTGTCAAAAAAGAGACAAAATTACTGTGGATTTGATGGTTTCCATTCCCCTGTGGTACCTAAAGCTCCCAGGTCCATAAGAAGAAATCCACATAAGAAATCATCAACAGGCAATGAAATCTGTGCCTTTGAGTTACTAGCAGCTGTAGCTGGCAAATTACTACAGGAAAGTGAAGGTTCTGCATCTAGCAATAGTCCAGAACACAAAGATCAAATCAACATTCCTAAAGACAATGTGAAACAAGAACCACTTGAAGA...

CDS

Download CDS FASTA

1806 bp · LXL04_012370|LXL04_012370|OH1004|CDS

ATGGTGTCAAAAAAGAGACAAAATTACTGTGGATTTGATGGTTTCCATTCCCCTGTGGTACCTAAAGCTCCCAGGTCCATAAGAAGAAATCCACATAAGAAATCATCAACAGGCAATGAAATCTGTGCCTTTGAGTTACTAGCAGCTGTAGCTGGCAAATTACTACAGGAAAGTGAAGGTTCTGCATCTAGCAATAGTCCAGAACACAAAGATCAAATCAACATTCCTAAAGACAATGTGAAACAAGAACCACTTGAAGA...

Protein

Download Protein FASTA

601 aa · LXL04_012370|LXL04_012370|OH1004|PROTEIN

MVSKKRQNYCGFDGFHSPVVPKAPRSIRRNPHKKSSTGNEICAFELLAAVAGKLLQESEGSASSNSPEHKDQINIPKDNVKQEPLEEVKVKPDLDHGCCAESQFIPEIPSNNLELKLEPPLKDSILSDNDSGLEHASIVTTQDFFTNVKLEGSDSKNIAVNTPSKSEGDFMDSNIPKIIEKESDKKSYSSVHEHEDLLHLPFYSDSVPLRRRGRNVKKIGNVRDDDENYSFSCTTKMKAFRLQSRGGYGYRRMRKMFSSK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012370`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012370

Location Chr03:11195824-11197971 (+)

Description Similar to TRP3: Telomere repeat-binding protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12560`	Binds specifically to the plant telomeric double-stranded DNA sequences.	No verified direct reference in this release
`At1g07540`	Binds specifically to the plant telomeric double-stranded DNA sequences.	No verified direct reference in this release
`At5g13820`	Binds specifically to the plant telomeric double-stranded DNA sequences 5'-TTTAGGG-3'.	No verified direct reference in this release
`At3g46590`	Binds specifically to the plant telomeric double-stranded DNA sequences.	AtTBP2 and AtTRP2 in Arabidopsis encode proteins that bind plant telomeric DNA and induce DNA bending in vitro.2005 · DOI: 10.1007/s00438-004-1096-3

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0817800`	Binds the telomeric double-stranded 5'TTTAGGG-3' repeat and regulates telomere length and structure.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012370 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0032204 regulation of telomere maintenance Biological Process

GO:0000781 chromosome, telomeric region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003691 double-stranded telomeric DNA binding Molecular Function

GO:0008301 DNA binding, bending Molecular Function

GO:0042162 telomeric DNA binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G07540

ath:AT3G12560

ath:AT3G46590

ath:AT5G13820

dosa:Os02g0817800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.980

Rank 1 · LXL04_012370 · OH-1004

Cytoplasm0.070

Rank 2 · LXL04_012370 · OH-1004

Cell membrane0.021

Rank 3 · LXL04_012370 · OH-1004

Endoplasmic reticulum0.013

Rank 4 · LXL04_012370 · OH-1004

Plastid0.011

Rank 5 · LXL04_012370 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23603.2Ubiquitin_TPR1310-376 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012370	`PF23603.2`	Ubiquitin_TPR1	310	376	2.1e-35	121.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C7B1`	Arabidopsis thaliana	Telomere repeat-binding protein 3	38.426%	Swiss-Prot	moderate database homology
`Q6R0E3`	Arabidopsis thaliana	Telomere repeat-binding protein 5	38.815%	Swiss-Prot	moderate database homology
`Q9FFY9`	Arabidopsis thaliana	Telomere repeat-binding protein 4	39.759%	Swiss-Prot	moderate database homology
`Q9SNB9`	Arabidopsis thaliana	Telomere repeat-binding protein 2	44.307%	Swiss-Prot	moderate database homology
`Q9LL45`	Oryza sativa subsp. japonica	Telomere-binding protein 1	32.644%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card