LXL04_012273 | RubberDandelionOmics

Gene overview

LXL04_012273

Reference: OH-1004 Chr: Chr03 Coordinates: 9552020-9553450 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

858 bp · LXL04_012273|LXL04_012273|OH1004|cDNA

ATGGCGTCGGCAGATCAGACAGTGCTCCAGTTCGTTCCGTTGTCTACTAGTTTGTCAGCCAAGGTTCATCCTCTTGTTATTTTTAACATATGTGACTGTTTCGTGAGACGCCCGGACCAAGCCGAGAGAGTCATCGGAACCCTTCTTGGATCCATTCTCCCCGACGGCACCGTTGATATTCGTAATTCGTATGTCGTTCCTCACAACGAATCGTCTGACCAGGTCGCCCTGGATATAGATTATCATCACAACTTGCTGTC...

CDS

Download CDS FASTA

858 bp · LXL04_012273|LXL04_012273|OH1004|CDS

ATGGCGTCGGCAGATCAGACAGTGCTCCAGTTCGTTCCGTTGTCTACTAGTTTGTCAGCCAAGGTTCATCCTCTTGTTATTTTTAACATATGTGACTGTTTCGTGAGACGCCCGGACCAAGCCGAGAGAGTCATCGGAACCCTTCTTGGATCCATTCTCCCCGACGGCACCGTTGATATTCGTAATTCGTATGTCGTTCCTCACAACGAATCGTCTGACCAGGTCGCCCTGGATATAGATTATCATCACAACTTGCTGTC...

Protein

Download Protein FASTA

285 aa · LXL04_012273|LXL04_012273|OH1004|PROTEIN

MASADQTVLQFVPLSTSLSAKVHPLVIFNICDCFVRRPDQAERVIGTLLGSILPDGTVDIRNSYVVPHNESSDQVALDIDYHHNLLSSHQKVNPKEVIVGWFSTGFGVTGGSALIHEFYSREVSNPVHLTVDTGFTNGEASIKAFVSINLSLGDQQLAAQFQEIPLDLRMVEAERVGFEILKTTAVDKLPSDMEGMEATMERLLALIDDTYKYVDDVVEGRVAPDNTVGRFISETVSSVPKMSPPAFDKLVNDSLQDQLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012273`
TK1151 ID	TkA02G576850
OH-1004 ID	LXL04_012273
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012273

Location Chr03:9552020-9553450 (-)

Description Similar to TIF3F1: Eukaryotic translation initiation factor 3 subunit F

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g39990`	Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012273 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001732 formation of cytoplasmic translation initiation complex Biological Process

GO:0006413 translational initiation Biological Process

GO:0006508 proteolysis Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009846 pollen germination Biological Process

GO:0075522 IRES-dependent viral translational initiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005852 eukaryotic translation initiation factor 3 complex Cellular Component

KEGG gene cross-reference

ath:AT2G39990

hsa:8665

mmu:66085

ptr:451007

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.733

Rank 1 · LXL04_012273 · OH-1004

Nucleus0.534

Rank 2 · LXL04_012273 · OH-1004

Lysosome / Vacuole0.044

Rank 3 · LXL04_012273 · OH-1004

Endoplasmic reticulum0.044

Rank 4 · LXL04_012273 · OH-1004

Golgi apparatus0.042

Rank 5 · LXL04_012273 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01398.27JAB17-123 aa

PF13012.12MitMem_reg172-279 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012273	`PF01398.27`	JAB	17	123	4.3e-25	88.5
LXL04_012273	`PF13012.12`	MitMem_reg	172	279	3.9e-30	104.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04202`	Arabidopsis thaliana	Eukaryotic translation initiation factor 3 subunit F	76.289%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card