Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1914 bp · LXL04_012232|LXL04_012232|OH1004|cDNA
ATGGAACCCTCTGACATCGAAGCCGTACTCCATTTCTTCAGAAAAAACCATCTTTCAGTCTCTGAATCCGCGCTCATCGACGACATCTTTGAGAAATCCCAGCTCGGTTCTTCCGATTTCCACGATTTTCTCTTTCCTCCGTCCCTTCCACCTCTCAAGATTCCCGCTGCTCCCCGTCTTCCTCCGCCATTGAAACCGGCGGACGATATTGCAACCTCCGATGCTTCTTCTGATCAGGAGTTCGCCAGCTTCGGTTCGTC...
1914 bp · LXL04_012232|LXL04_012232|OH1004|CDS
ATGGAACCCTCTGACATCGAAGCCGTACTCCATTTCTTCAGAAAAAACCATCTTTCAGTCTCTGAATCCGCGCTCATCGACGACATCTTTGAGAAATCCCAGCTCGGTTCTTCCGATTTCCACGATTTTCTCTTTCCTCCGTCCCTTCCACCTCTCAAGATTCCCGCTGCTCCCCGTCTTCCTCCGCCATTGAAACCGGCGGACGATATTGCAACCTCCGATGCTTCTTCTGATCAGGAGTTCGCCAGCTTCGGTTCGTC...
Protein
Download Protein FASTA637 aa · LXL04_012232|LXL04_012232|OH1004|PROTEIN
MEPSDIEAVLHFFRKNHLSVSESALIDDIFEKSQLGSSDFHDFLFPPSLPPLKIPAAPRLPPPLKPADDIATSDASSDQEFASFGSSSTDLCSSDFTKPYGIRILTGANSHASSDRLSQFDTARDYHEFDMQNDIDWYREKNEDYAMPSWFDHSDPFGHPTEDKYVTTLDENNQNENREIVLDPLLQPLEKTNHLHKVWPTSVAYLKDGLEVTDFEHHIQSATLCSSLEGIDLNGKNCVDDLIADSYQDSQNKTTEKDVD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_012232 |
|---|---|
| TK1151 ID | TkA02G579480 |
| OH-1004 ID | LXL04_012232 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_012232 |
|---|---|
| Location | Chr03:8890190-8893478 (+) |
| Description | Similar to ppk15: Serine/threonine-protein kinase ppk15 (Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0010972 negative regulation of G2/M transition of mitotic cell cycle Biological Process GO:0023052 signaling Biological Process GO:0030950 establishment or maintenance of actin cytoskeleton polarity Biological Process GO:0031569 mitotic G2 cell size control checkpoint signaling Biological Process GO:0032878 regulation of establishment or maintenance of cell polarity Biological Process GO:0032956 regulation of actin cytoskeleton organization Biological Process GO:0051519 activation of bipolar cell growth Biological Process GO:0061245 establishment or maintenance of bipolar cell polarity Biological Process GO:1903067 negative regulation of protein localization to cell tip Biological Process GO:1903077 negative regulation of protein localization to plasma membrane Biological Process GO:1903138 negative regulation of cell integrity MAPK cascade Biological Process GO:1903500 negative regulation of mitotic actomyosin contractile ring assembly Biological Process |
| KEGG gene cross-reference | ddi:DDB_G0293750 hsa:8798 mmu:101320 spo:2541889 spo:2542228 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00069.32Pkinase329-631 aaPF07714.24PK_Tyr_Ser-Thr332-529 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_012232 | PF00069.32 | Pkinase | 329 | 631 | 2.5e-51 | 175.3 |
| LXL04_012232 | PF07714.24 | PK_Tyr_Ser-Thr | 332 | 529 | 3e-17 | 63.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.