LXL04_012195 | RubberDandelionOmics

Gene overview

LXL04_012195

Reference: OH-1004 Chr: Chr03 Coordinates: 8150213-8150940 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

405 bp · LXL04_012195|LXL04_012195|OH1004|cDNA

ATGGTGCTGTTTTTGTGTCGGAGTAAGCAAGCACAGCTCAGAGCTTTATCAATCCAGTTCAAAAGATGCTATTTTCATATTCATGGCTCCTCTTCTTCAGTTATCCAGGGACCTTCAATGGGTGTTATGAACTGTCAAATTTTGATTTTACACAGGACTGGATCCCATCTTGGAAACCATGTGCGATTCTTTGAAGCTCCAGTGCAGGTCAAACCAAAGTATGAAGAGAAGGATAAGGGACGTCCACGAATGAATGAACA...

CDS

Download CDS FASTA

405 bp · LXL04_012195|LXL04_012195|OH1004|CDS

ATGGTGCTGTTTTTGTGTCGGAGTAAGCAAGCACAGCTCAGAGCTTTATCAATCCAGTTCAAAAGATGCTATTTTCATATTCATGGCTCCTCTTCTTCAGTTATCCAGGGACCTTCAATGGGTGTTATGAACTGTCAAATTTTGATTTTACACAGGACTGGATCCCATCTTGGAAACCATGTGCGATTCTTTGAAGCTCCAGTGCAGGTCAAACCAAAGTATGAAGAGAAGGATAAGGGACGTCCACGAATGAATGAACA...

Protein

Download Protein FASTA

134 aa · LXL04_012195|LXL04_012195|OH1004|PROTEIN

MVLFLCRSKQAQLRALSIQFKRCYFHIHGSSSSVIQGPSMGVMNCQILILHRTGSHLGNHVRFFEAPVQVKPKYEEKDKGRPRMNEQISSQMFARRLNVDLVEVQQDAKPLVCKLMDYNKEMYLRQVKEKEQTK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012195`
TK1151 ID	TkA01G007870
OH-1004 ID	LXL04_012195
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	76.500
Protein coverage (%)	TK1151 38.601 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012195

Location Chr03:8150213-8150940 (+)

Description Similar to IF3-1: Translation initiation factor IF3-1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g34360`	IF-3 binds to the 30S ribosomal subunit and shifts the equilibrium between 70S ribosomes and their 50S and 30S subunits in favor of the free subunits, thus enhancing the availability of 30S subunits on which protein synthesis initiation begins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012195 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0032790 ribosome disassembly Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0003743 translation initiation factor activity Molecular Function

GO:0043022 ribosome binding Molecular Function

KEGG gene cross-reference

ath:AT1G34360

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.935

Rank 1 · LXL04_012195 · OH-1004

Nucleus0.054

Rank 2 · LXL04_012195 · OH-1004

Cytoplasm0.037

Rank 3 · LXL04_012195 · OH-1004

Cell membrane0.011

Rank 4 · LXL04_012195 · OH-1004

Plastid0.007

Rank 5 · LXL04_012195 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05198.22IF3_N93-132 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012195	`PF05198.22`	IF3_N	93	132	1.3e-11	45.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NLP2`	Arabidopsis thaliana	Translation initiation factor IF3-1, mitochondrial	31.304%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card