LXL04_012184 | RubberDandelionOmics

Gene overview

LXL04_012184

Reference: OH-1004 Chr: Chr03 Coordinates: 8022128-8024945 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2085 bp · LXL04_012184|LXL04_012184|OH1004|cDNA

ATGGGTGGTAAGAAGCGAAGTAAACAGAAATTCATTGAAAAGGACATAAAAGAATCATCAACATTTACAAACTACAGCGCACCTGCAAGGAATTTAAGGAAAACCGACCTTGGTGCAGTTATATTCGGTTGCAAACACACTACAATCAACGAATGCCTTGCCAATAACCTCTTTGGTTTACCAGCTTCACATTTCTCTTACATTAAGAACATCAAAGAAGGCGTTCCTCTGTTTCTCTTCAACTACAGTGACAGAAAACT...

CDS

Download CDS FASTA

2085 bp · LXL04_012184|LXL04_012184|OH1004|CDS

ATGGGTGGTAAGAAGCGAAGTAAACAGAAATTCATTGAAAAGGACATAAAAGAATCATCAACATTTACAAACTACAGCGCACCTGCAAGGAATTTAAGGAAAACCGACCTTGGTGCAGTTATATTCGGTTGCAAACACACTACAATCAACGAATGCCTTGCCAATAACCTCTTTGGTTTACCAGCTTCACATTTCTCTTACATTAAGAACATCAAAGAAGGCGTTCCTCTGTTTCTCTTCAACTACAGTGACAGAAAACT...

Protein

Download Protein FASTA

694 aa · LXL04_012184|LXL04_012184|OH1004|PROTEIN

MGGKKRSKQKFIEKDIKESSTFTNYSAPARNLRKTDLGAVIFGCKHTTINECLANNLFGLPASHFSYIKNIKEGVPLFLFNYSDRKLHGVFEATSPGQMNLNRYAWLTDDDNYAYTSYPAQVRVRVRQQCHPLSESQFGPIIEKNYYEKQHFYFELDNDQTKKLISLFTSSPVNIPLSSFPVSVSRQTPGPSYASTTTTTSFQQPTGTWSSLFKSESNFKHEDDRDKEYEEDKSNFTDGNTWEDAECDKTWESDWCSEGN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012184`
TK1151 ID	TkA02G582930
OH-1004 ID	LXL04_012184
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_012184`
Location	Chr03:8022128-8024945 (+)
Description	Similar to KLHL12: Kelch-like protein 12
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012184` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006513 protein monoubiquitination Biological Process GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0016055 Wnt signaling pathway Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0048208 COPII vesicle coating Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0030127 COPII vesicle coat Cellular Component GO:0030134 COPII-coated ER to Golgi transport vesicle Cellular Component GO:0031463 Cul3-RING ubiquitin ligase complex Cellular Component GO:0042802 identical protein binding Molecular Function GO:1990756 ubiquitin-like ligase-substrate adaptor activity Molecular Function
KEGG gene cross-reference	hsa:59349 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.553

Rank 1 · LXL04_012184 · OH-1004

Cytoplasm0.434

Rank 2 · LXL04_012184 · OH-1004

Cell membrane0.059

Rank 3 · LXL04_012184 · OH-1004

Endoplasmic reticulum0.038

Rank 4 · LXL04_012184 · OH-1004

Golgi apparatus0.033

Rank 5 · LXL04_012184 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10539.15Dev_Cell_Death39-168 aa

PF25210.2Kelch_FKB95499-604 aa

PF01344.32Kelch_1501-541 aa

PF24681.2Kelch_KLHDC2_KLHL20_DRC7503-683 aa

PF13415.13Beta-prop_FBX42506-664 aa

PF13964.13Beta-prop_Calicin511-671 aa

PF01344.32Kelch_1544-588 aa

PF07646.22Kelch_2546-587 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012184	`PF10539.15`	Dev_Cell_Death	39	168	1.8e-49	167.4
LXL04_012184	`PF25210.2`	Kelch_FKB95	499	604	8.1e-23	82.1
LXL04_012184	`PF01344.32`	Kelch_1	501	541	1.8e-47	159.1
LXL04_012184	`PF24681.2`	Kelch_KLHDC2_KLHL20_DRC7	503	683	1.1e-23	84.4
LXL04_012184	`PF13415.13`	Beta-prop_FBX42	506	664	1.4e-15	58.2
LXL04_012184	`PF13964.13`	Beta-prop_Calicin	511	671	3.3e-19	69.7
LXL04_012184	`PF01344.32`	Kelch_1	544	588	1.8e-47	159.1
LXL04_012184	`PF07646.22`	Kelch_2	546	587	3.2e-19	68.5
LXL04_012184	`PF24981.2`	Beta-prop_ATRN-LZTR1	556	681	8.6e-13	48.9
LXL04_012184	`PF01344.32`	Kelch_1	590	634	1.8e-47	159.1
LXL04_012184	`PF07646.22`	Kelch_2	590	634	3.2e-19	68.5
LXL04_012184	`PF25210.2`	Kelch_FKB95	592	677	8.1e-23	82.1
LXL04_012184	`PF01344.32`	Kelch_1	638	675	1.8e-47	159.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card