LXL04_012173 | RubberDandelionOmics

Gene overview

LXL04_012173

Reference: OH-1004 Chr: Chr03 Coordinates: 7817763-7821165 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1833 bp · LXL04_012173|LXL04_012173|OH1004|cDNA

ATGGAAGAAAAAGGATACACACAAGATGGCACAGTCGATCTTCGCAGGCAACCCGTGCTCTCTTCCAAAACTGGCAAATGGAAAGCTTGTGCGTTTTTAGTTGGGTATGAAGCGTTTGAAAGAATGGCGTTTTATGGGGTGGCATCAAATCTTGTGGTGTATTTGACAACACAGTTGCATGAAGATACAGTTTCGTCTGTAAGAAATGTCAATAATTGGTCAGGGGCAGTCTGGATGACTCCAATTTTTGGTGCGTATAT...

CDS

Download CDS FASTA

1833 bp · LXL04_012173|LXL04_012173|OH1004|CDS

ATGGAAGAAAAAGGATACACACAAGATGGCACAGTCGATCTTCGCAGGCAACCCGTGCTCTCTTCCAAAACTGGCAAATGGAAAGCTTGTGCGTTTTTAGTTGGGTATGAAGCGTTTGAAAGAATGGCGTTTTATGGGGTGGCATCAAATCTTGTGGTGTATTTGACAACACAGTTGCATGAAGATACAGTTTCGTCTGTAAGAAATGTCAATAATTGGTCAGGGGCAGTCTGGATGACTCCAATTTTTGGTGCGTATAT...

Protein

Download Protein FASTA

610 aa · LXL04_012173|LXL04_012173|OH1004|PROTEIN

MEEKGYTQDGTVDLRRQPVLSSKTGKWKACAFLVGYEAFERMAFYGVASNLVVYLTTQLHEDTVSSVRNVNNWSGAVWMTPIFGAYIADSYLGRFWTFTLSSLIYVLGMVLLTLAVSIKFLKPTCINGVCNKATTSQTAFFYSALYIIAIGAARVIFYGYSASLGSKIHECVIGVGGTKPNISTFGADQFDDFNPSEKRLKVSFFNWWMFSSFTGALVATLGLVYIQENLGWGLGYGIPTIGLILSLVIFYIGTPMYRHK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012173`
TK1151 ID	TkA02G583670
OH-1004 ID	LXL04_012173
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012173

Location Chr03:7817763-7821165 (-)

Description Similar to NPF5.1: Protein NRT1/ PTR FAMILY 5.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40460`	Protein NRT1/ PTR FAMILY 5.1.	No verified direct reference in this release
`At5g46050`	Peptide transporter involved in stress tolerance in seeds during germination and in defense against virulent bacterial pathogens.	Structural and functional characterization of AtPTR3, a stress-induced peptide transporter of Arabidopsis.2005 · DOI: 10.1007/s00894-005-0257-6 AtPTR3, a wound-induced peptide transporter needed for defence against virulent bacterial pathogens in Arabidopsis.2007 · DOI: 10.1007/s00425-006-0451-5
`At5g46040`	Peptide transporter.	No verified direct reference in this release
`At3g54140`	Peptide transporter.	AtPTR1, a plasma membrane peptide transporter expressed during seed germination and in vascular tissue of Arabidopsis.2004 · DOI: 10.1111/j.1365-313x.2004.02224.x AtPTR1 and AtPTR5 transport dipeptides in planta.2008 · DOI: 10.1104/pp.108.123844
`At5g01180`	Peptide transporter.	AtPTR1 and AtPTR5 transport dipeptides in planta.2008 · DOI: 10.1104/pp.108.123844

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012173 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0009624 response to nematode Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0015031 protein transport Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0042938 dipeptide transport Biological Process

GO:0042939 tripeptide transport Biological Process

GO:0043201 response to L-leucine Biological Process

KEGG gene cross-reference

ath:AT2G40460

ath:AT3G54140

ath:AT5G01180

ath:AT5G46040

ath:AT5G46050

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.768

Rank 1 · LXL04_012173 · OH-1004

Endoplasmic reticulum0.082

Rank 2 · LXL04_012173 · OH-1004

Cytoplasm0.069

Rank 3 · LXL04_012173 · OH-1004

Lysosome / Vacuole0.069

Rank 4 · LXL04_012173 · OH-1004

Mitochondrion0.030

Rank 5 · LXL04_012173 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00854.28PTR295-153 aa

PF00854.28PTR2172-545 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012173	`PF00854.28`	PTR2	95	153	3.7e-104	349.4
LXL04_012173	`PF00854.28`	PTR2	172	545	3.7e-104	349.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZR7`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 5.1	68.369%	Swiss-Prot	strong database homology
`Q9FNL7`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 5.2	48.020%	Swiss-Prot	moderate database homology
`Q9FNL8`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 5.3	46.865%	Swiss-Prot	moderate database homology
`Q9M390`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 8.1	43.294%	Swiss-Prot	moderate database homology
`Q9LFB8`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 8.2	42.393%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card