LXL04_012172 | RubberDandelionOmics

Gene overview

LXL04_012172

Reference: OH-1004 Chr: Chr03 Coordinates: 7803999-7805231 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

702 bp · LXL04_012172|LXL04_012172|OH1004|cDNA

ATGTCCAGAGAAAGGGAGAGATTTGATGAGATAGGGAAGAAGATCAAGAGAGACATCGATGCGTCATTTCAATTGGGAAGGAGACATATGTTAGGGCTTCCCGGAACCCTAAACACCATCACACCTTGTGCCGCTTGCAAGCTTTTACGCCGTCGATGTGCTCAAGAATGCCCTTTTTCTCCTTATTTTTCCCCTCATGAACCTCAAAAGTTTGCCTCTGTTCACAAAGTTTTTGGTGCAAGTAATGTCTCCAAGTTGCT...

CDS

Download CDS FASTA

702 bp · LXL04_012172|LXL04_012172|OH1004|CDS

ATGTCCAGAGAAAGGGAGAGATTTGATGAGATAGGGAAGAAGATCAAGAGAGACATCGATGCGTCATTTCAATTGGGAAGGAGACATATGTTAGGGCTTCCCGGAACCCTAAACACCATCACACCTTGTGCCGCTTGCAAGCTTTTACGCCGTCGATGTGCTCAAGAATGCCCTTTTTCTCCTTATTTTTCCCCTCATGAACCTCAAAAGTTTGCCTCTGTTCACAAAGTTTTTGGTGCAAGTAATGTCTCCAAGTTGCT...

Protein

Download Protein FASTA

233 aa · LXL04_012172|LXL04_012172|OH1004|PROTEIN

MSRERERFDEIGKKIKRDIDASFQLGRRHMLGLPGTLNTITPCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKLLMEVPENQRADAANSLVYEANVRLRDPVYGCMGAISALQHQVQSLQAELNAVRAEILRYKYNESTHHDHHHNIIPSIHHLALFSTGGVIPVTTQPPPPVPSQSPLPPPPPPPPPLPPANSSSSSMYTPPSATTDYSTITNDNVSYFG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012172`
TK1151 ID	TkA02G583740
OH-1004 ID	LXL04_012172
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012172

Location Chr03:7803999-7805231 (+)

Description Similar to LBD15: LOB domain-containing protein 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40470`	LOB domain-containing protein 15.	No verified direct reference in this release
`At2g30340`	LOB domain-containing protein 13.	No verified direct reference in this release
`At2g30130`	LOB domain-containing protein 12.	No verified direct reference in this release
`At3g27650`	LOB domain-containing protein 25.	No verified direct reference in this release
`At1g31320`	LOB domain-containing protein 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012172 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010016 shoot system morphogenesis Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010311 lateral root formation Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048364 root development Biological Process

GO:0080117 secondary growth Biological Process

GO:1905177 tracheary element differentiation Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G31320

ath:AT2G30130

ath:AT2G30340

ath:AT2G40470

ath:AT3G27650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.964

Rank 1 · LXL04_012172 · OH-1004

Cytoplasm0.094

Rank 2 · LXL04_012172 · OH-1004

Cell membrane0.026

Rank 3 · LXL04_012172 · OH-1004

Endoplasmic reticulum0.019

Rank 4 · LXL04_012172 · OH-1004

Plastid0.012

Rank 5 · LXL04_012172 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03195.20LOB42-139 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012172	`PF03195.20`	LOB	42	139	1.8e-40	138.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L5T5`	Arabidopsis thaliana	LOB domain-containing protein 15	63.559%	Swiss-Prot	strong database homology
`Q9AT61`	Arabidopsis thaliana	LOB domain-containing protein 13	71.429%	Swiss-Prot	moderate database homology
`Q8LBW3`	Arabidopsis thaliana	LOB domain-containing protein 12	59.286%	Swiss-Prot	moderate database homology
`Q8L8Q3`	Arabidopsis thaliana	LOB domain-containing protein 25	59.829%	Swiss-Prot	moderate database homology
`Q9SHE9`	Arabidopsis thaliana	LOB domain-containing protein 4	62.931%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card