LXL04_012103 | RubberDandelionOmics

Gene overview

LXL04_012103

Reference: OH-1004 Chr: Chr03 Coordinates: 6405940-6407562 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1110 bp · LXL04_012103|LXL04_012103|OH1004|cDNA

ATGAGAGCACTAGAACAAGAAATATCAGCGGATCAAGACCCCAAGGCTCGAATCCTTCTCGGCCTCTGGATTTTCTCTGTTCTATCTCTTGTTCTAATAGCTCTTGGATCCGATAAAGATGGATCTGTGTCCATAACCAACATGGCCCACAAGTTTTACCCTCCTAAAcacccaccaccaccaccaccaccaccaccaccgcaaGAACCACCATCGCCACCGACATCATCAAAAGCTGATCATGAAAAGAGTTCTGAGGA...

CDS

Download CDS FASTA

1110 bp · LXL04_012103|LXL04_012103|OH1004|CDS

ATGAGAGCACTAGAACAAGAAATATCAGCGGATCAAGACCCCAAGGCTCGAATCCTTCTCGGCCTCTGGATTTTCTCTGTTCTATCTCTTGTTCTAATAGCTCTTGGATCCGATAAAGATGGATCTGTGTCCATAACCAACATGGCCCACAAGTTTTACCCTCCTAAACACCCACCACCACCACCACCACCACCACCACCGCAAGAACCACCATCGCCACCGACATCATCAAAAGCTGATCATGAAAAGAGTTCTGAGGA...

Protein

Download Protein FASTA

369 aa · LXL04_012103|LXL04_012103|OH1004|PROTEIN

MRALEQEISADQDPKARILLGLWIFSVLSLVLIALGSDKDGSVSITNMAHKFYPPKHPPPPPPPPPPQEPPSPPTSSKADHEKSSEDPELEEALAIVSAKHKTVIIAFVDKAYTEGDTPMLDIFLDGFWIGEDTRKLIKHLLIVAVDQTAYDRCTLLQLHCYKLKTEGVEYDGAKKPFMSDDFMKMMWRRILFLGDVLKHGYNFIFTDMDVLWLGNPFPLLKDEHLDLQVSVDYFNGNPWSEDNPINTGFYMMRSNNKTI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012103`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012103

Location Chr03:6405940-6407562 (+)

Description Similar to At1g28695: Uncharacterized protein At1g28695

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28695`	Uncharacterized protein At1g28695.	No verified direct reference in this release
`At4g15970`	Uncharacterized protein At4g15970.	No verified direct reference in this release
`At1g70630`	Beta-arabinofuranosyltransferase that transfers specifically an arabinosyl residue from UDP-arabinofuranose to the monosaccharide galactose or beta-methyl-galactoside in vitro.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012103 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0042546 cell wall biogenesis Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016757 glycosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G28695

ath:AT1G70630

ath:AT4G15970

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.779

Rank 1 · LXL04_012103 · OH-1004

Endoplasmic reticulum0.089

Rank 2 · LXL04_012103 · OH-1004

Cytoplasm0.069

Rank 3 · LXL04_012103 · OH-1004

Cell membrane0.066

Rank 4 · LXL04_012103 · OH-1004

Extracellular0.052

Rank 5 · LXL04_012103 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03407.23Nucleotid_trans137-336 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012103	`PF03407.23`	Nucleotid_trans	137	336	1.4e-57	195.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3E6Y3`	Arabidopsis thaliana	Uncharacterized protein At1g28695	53.147%	Swiss-Prot	strong database homology
`P0C042`	Arabidopsis thaliana	Uncharacterized protein At4g15970	37.248%	Swiss-Prot	moderate database homology
`F4I6V0`	Arabidopsis thaliana	Beta-arabinofuranosyltransferase RAY1	25.751%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card