LXL04_012089 | RubberDandelionOmics

Gene overview

LXL04_012089

Reference: OH-1004 Chr: Chr03 Coordinates: 6140209-6142873 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

468 bp · LXL04_012089|LXL04_012089|OH1004|cDNA

ATGGCGGAAGAGGAGAACGGGGCGACGGCCGGTGGGGAGTTCTATCTGAGGTACTACGTAGGGCACAAGGGAAAGTTTGGACACGAGTTTCTGGAGTTCGAGTTCCGACCCGACGGGAAGCTCCGTTACGCCAACAACTCCAACTACAAGAACGACACCATGATCCGTAAGGAGGTCTTTCTCACCCCGTCTGTCCTCAAAGAGTGCCGTCGTATCGTCTCCGATTCCGATATTATGAAGGAAGATGACAACAATTGGCC...

CDS

Download CDS FASTA

468 bp · LXL04_012089|LXL04_012089|OH1004|CDS

ATGGCGGAAGAGGAGAACGGGGCGACGGCCGGTGGGGAGTTCTATCTGAGGTACTACGTAGGGCACAAGGGAAAGTTTGGACACGAGTTTCTGGAGTTCGAGTTCCGACCCGACGGGAAGCTCCGTTACGCCAACAACTCCAACTACAAGAACGACACCATGATCCGTAAGGAGGTCTTTCTCACCCCGTCTGTCCTCAAAGAGTGCCGTCGTATCGTCTCCGATTCCGATATTATGAAGGAAGATGACAACAATTGGCC...

Protein

Download Protein FASTA

155 aa · LXL04_012089|LXL04_012089|OH1004|PROTEIN

MAEEENGATAGGEFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKEVFLTPSVLKECRRIVSDSDIMKEDDNNWPEPDRVGRQELEIVMGNEHISFTTSKIGSLMDVQTSKDPEGLRIFYYLVQDLKCFVFSLISLHFKIKPI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012089`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012089

Location Chr03:6140209-6142873 (+)

Description Similar to MAGO2: Protein mago nashi homolog 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02140`	Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs.	Functional interconnections of Arabidopsis exon junction complex proteins and genes at multiple steps of gene expression.2011 · DOI: 10.1093/jxb/err202 A New Mutation, hap1-2, Reveals a C Terminal Domain Function in AtMago Protein and Its Biological Effects in Male Gametophyte Development in Arabidopsis thaliana.2016 · DOI: 10.1371/journal.pone.0148200

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0287200`	Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs.	Uncovering Divergence of Rice Exon Junction Complex Core Heterodimer Gene Duplication Reveals Their Essential Role in Growth, Development, and Reproduction.2014 · DOI: 10.1104/pp.114.237958 Targeting MAGO proteins with a peptide aptamer reinforces their essential roles in multiple rice developmental pathways.2014 · DOI: 10.1111/tpj.12672
`Os08g0107900`	Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs.	Uncovering Divergence of Rice Exon Junction Complex Core Heterodimer Gene Duplication Reveals Their Essential Role in Growth, Development, and Reproduction.2014 · DOI: 10.1104/pp.114.237958 Targeting MAGO proteins with a peptide aptamer reinforces their essential roles in multiple rice developmental pathways.2014 · DOI: 10.1111/tpj.12672

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012089 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Biological Process

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006397 mRNA processing Biological Process

GO:0006406 mRNA export from nucleus Biological Process

GO:0006417 regulation of translation Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0050684 regulation of mRNA processing Biological Process

GO:0051028 mRNA transport Biological Process

GO:2000622 regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Biological Process

KEGG gene cross-reference

ath:AT1G02140

dosa:Os08g0107900

dosa:Os12g0287200

mmu:66441

osa:4351998

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.613

Rank 1 · LXL04_012089 · OH-1004

Cytoplasm0.494

Rank 2 · LXL04_012089 · OH-1004

Cell membrane0.041

Rank 3 · LXL04_012089 · OH-1004

Mitochondrion0.041

Rank 4 · LXL04_012089 · OH-1004

Endoplasmic reticulum0.036

Rank 5 · LXL04_012089 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02792.20Mago_nashi14-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012089	`PF02792.20`	Mago_nashi	14	155	5.3e-79	263.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23676`	Arabidopsis thaliana	Protein mago nashi homolog	86.577%	Swiss-Prot	strong database homology
`P49030`	Oryza sativa subsp. japonica	Protein mago nashi homolog 2	92.466%	Swiss-Prot	strong database homology
`A0A0P0XB70`	Oryza sativa subsp. japonica	Protein mago nashi homolog 1	90.909%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card