LXL04_012038 | RubberDandelionOmics

Gene overview

LXL04_012038

Reference: OH-1004 Chr: Chr03 Coordinates: 5315408-5326933 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1473 bp · LXL04_012038|LXL04_012038|OH1004|cDNA

ATGAAATCCATGACCCCGATGGGAAGACTGGTCAATCATCTGAAGATGGCAGTTGCAGTTGAAGACGTAATGGATCTTAAGGCTAGTCATAGCCCCCCTGTTCTTACTGATCCTACACCAATTAACAAACCAAGATTAGGAATTCACTTCTCTCAAGATCCTTTTTTGACAATTCCATGGAAGAAACCTGGTGGAGTTCTTGATGATGTTCGGGCATCTAATTGGTTAGATGCCATGAAATCTTCATCTCCTAGGAACAT...

CDS

Download CDS FASTA

1473 bp · LXL04_012038|LXL04_012038|OH1004|CDS

ATGAAATCCATGACCCCGATGGGAAGACTGGTCAATCATCTGAAGATGGCAGTTGCAGTTGAAGACGTAATGGATCTTAAGGCTAGTCATAGCCCCCCTGTTCTTACTGATCCTACACCAATTAACAAACCAAGATTAGGAATTCACTTCTCTCAAGATCCTTTTTTGACAATTCCATGGAAGAAACCTGGTGGAGTTCTTGATGATGTTCGGGCATCTAATTGGTTAGATGCCATGAAATCTTCATCTCCTAGGAACAT...

Protein

Download Protein FASTA

490 aa · LXL04_012038|LXL04_012038|OH1004|PROTEIN

MKSMTPMGRLVNHLKMAVAVEDVMDLKASHSPPVLTDPTPINKPRLGIHFSQDPFLTIPWKKPGGVLDDVRASNWLDAMKSSSPRNITKHYGVEFSSSDADMAYRDWMLKYPSALTSFEQIANNARGKRIALFLDYDGTLSPIVDNPDHAFMSNAMRAAVRNVAKYIPTAIISGRSREKVRKFVGLKELYYAGSHGMDIMGPVHNEEVKEGNLYQPASEFLPMINEVFVSLVEITKNIQGAKVENNKFCVSVHYRNVDEK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012038`
TK1151 ID	TkA02G591180
OH-1004 ID	LXL04_012038
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 95.879 / OH-1004 71.224 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012038

Location Chr03:5315408-5326933 (-)

Description Similar to TPPA: Trehalose-phosphate phosphatase A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g51460`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	Trehalose-6-phosphate phosphatases from Arabidopsis thaliana: identification by functional complementation of the yeast tps2 mutant.1998 · DOI: 10.1046/j.1365-313x.1998.00064.x
`At4g22590`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	No verified direct reference in this release
`At4g12430`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0661100`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	Functional identification of a trehalose 6-phosphate phosphatase gene that is involved in transient induction of trehalose biosynthesis during chilling stress in rice.2005 · DOI: 10.1007/s11103-005-7404-4 Biochemical characterization of rice trehalose-6-phosphate phosphatases supports distinctive functions of these plant enzymes.2007 · DOI: 10.1111/j.1742-4658.2007.05658.x Overexpression of the trehalose-6-phosphate phosphatase gene OsTPP1 confers stress tolerance in rice and results in the activation of stress responsive genes.2008 · DOI: 10.1007/s00425-008-0729-x
`Os10g0553300`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012038 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005992 trehalose biosynthetic process Biological Process

GO:0009409 response to cold Biological Process

GO:0009651 response to salt stress Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004805 trehalose-phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT4G12430

ath:AT4G22590

ath:AT5G51460

dosa:Os02g0661100

dosa:Os10g0553300

osa:4349333

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.338

Rank 1 · LXL04_012038 · OH-1004

Nucleus0.226

Rank 2 · LXL04_012038 · OH-1004

Cytoplasm0.201

Rank 3 · LXL04_012038 · OH-1004

Mitochondrion0.139

Rank 4 · LXL04_012038 · OH-1004

Cell membrane0.102

Rank 5 · LXL04_012038 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02358.23Trehalose_PPase133-363 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012038	`PF02358.23`	Trehalose_PPase	133	363	2.5e-68	230.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64896`	Arabidopsis thaliana	Trehalose-phosphate phosphatase A	62.264%	Swiss-Prot	moderate database homology
`Q9SUW0`	Arabidopsis thaliana	Probable trehalose-phosphate phosphatase G	62.291%	Swiss-Prot	moderate database homology
`Q9SU39`	Arabidopsis thaliana	Probable trehalose-phosphate phosphatase F	63.636%	Swiss-Prot	moderate database homology
`Q75WV3`	Oryza sativa subsp. japonica	Probable trehalose-phosphate phosphatase 1	59.384%	Swiss-Prot	moderate database homology
`Q9FWQ2`	Oryza sativa subsp. japonica	Probable trehalose-phosphate phosphatase 2	55.764%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card