LXL04_011922 | RubberDandelionOmics

Gene overview

LXL04_011922

Reference: OH-1004 Chr: Chr03 Coordinates: 2780080-2781096 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1017 bp · LXL04_011922|LXL04_011922|OH1004|cDNA

ATGGCGACCATAATCGGCAATCTCAGTCCATCCGCCGGCAGATCGCCGATCTTCATTGATGCACCCACAATCCGGTCAGTTCTCCCCTACAGATCCCTAATTAACCACCTCCAAACATCTCTCTCTTCCGCCACATCCGTTATCCAATCCCCGATCCGCCATTCGCACCAAACATCCTCATCATCCACCCTCCTTCTCATGCCTTCGTGGTCTCTCTCCACAGCTACCCTCCCTTACATCGGCGTCAAACTCGTCACAAC...

CDS

Download CDS FASTA

1017 bp · LXL04_011922|LXL04_011922|OH1004|CDS

ATGGCGACCATAATCGGCAATCTCAGTCCATCCGCCGGCAGATCGCCGATCTTCATTGATGCACCCACAATCCGGTCAGTTCTCCCCTACAGATCCCTAATTAACCACCTCCAAACATCTCTCTCTTCCGCCACATCCGTTATCCAATCCCCGATCCGCCATTCGCACCAAACATCCTCATCATCCACCCTCCTTCTCATGCCTTCGTGGTCTCTCTCCACAGCTACCCTCCCTTACATCGGCGTCAAACTCGTCACAAC...

Protein

Download Protein FASTA

338 aa · LXL04_011922|LXL04_011922|OH1004|PROTEIN

MATIIGNLSPSAGRSPIFIDAPTIRSVLPYRSLINHLQTSLSSATSVIQSPIRHSHQTSSSSTLLLMPSWSLSTATLPYIGVKLVTTHPNNSTLNLPGVHASYVLFNSVTGQTLASMDGTELTLRRTSCISAVASHYLSNKNSRVLLSVGAGSLAPHLIKAHLTTRPSINHVMIWNRTSQKSKKLVEEIGKESGMEGVRFEVCEDIASAAAIADIISCATNSETPLVLGKWLKAGAHLDLVGSYKPSMMECDDEAVRRGR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011922`
TK1151 ID	TkA02G603710
OH-1004 ID	LXL04_011922
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011922

Location Chr03:2780080-2781096 (+)

Description Similar to SARD4: Protein SAR DEFICIENT 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g52810`	Involved in the biosynthesis of pipecolate (Pip), a metabolite that orchestrates defense amplification, positive regulation of salicylic acid (SA) biosynthesis, and priming to guarantee effective local resistance induction and the establishment of systemic acquired resistance (SAR).	Characterization of a Pipecolic Acid Biosynthesis Pathway Required for Systemic Acquired Resistance.2016 · DOI: 10.1105/tpc.16.00486

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011922 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009627 systemic acquired resistance Biological Process

GO:0019752 carboxylic acid metabolic process Biological Process

GO:0062034 L-pipecolic acid biosynthetic process Biological Process

GO:1901672 positive regulation of systemic acquired resistance Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016491 oxidoreductase activity Molecular Function

GO:0062046 dehydropipecolic acid reductase activity Molecular Function

KEGG gene cross-reference

ath:AT5G52810

bce:BC0906

cps:CPS_1455

pde:Pden_1185

spo:2541644

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.405

Rank 1 · LXL04_011922 · OH-1004

Mitochondrion0.298

Rank 2 · LXL04_011922 · OH-1004

Nucleus0.208

Rank 3 · LXL04_011922 · OH-1004

Peroxisome0.107

Rank 4 · LXL04_011922 · OH-1004

Plastid0.102

Rank 5 · LXL04_011922 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02423.22OCD_Mu_crystall30-335 aa

PF01488.27Shikimate_DH136-234 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011922	`PF02423.22`	OCD_Mu_crystall	30	335	8.4e-57	193.2
LXL04_011922	`PF01488.27`	Shikimate_DH	136	234	6.1e-10	40.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLY0`	Arabidopsis thaliana	Protein SAR DEFICIENT 4	54.259%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card