LXL04_011906 | RubberDandelionOmics

Gene overview

LXL04_011906

Reference: OH-1004 Chr: Chr03 Coordinates: 2558443-2560709 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

921 bp · LXL04_011906|LXL04_011906|OH1004|cDNA

ATGGCGATAGATCTCTCAGTTCTTCTTGTTTTGGTGTTTACCTGTTGTTTATCGAGCTGTTCTGCAGAAAGCCGAAAGGAACTCAGAACCAAAGAGAATGTTATACAATTAGGCCATCACCATGCACTTCCACCCAACACAATTGACCCATCACGAGTTACTCAACTCTCTTGGCGCCCAAGGGTATTCTTGTACAAAGGTTTCCTATCTGATGAAGAGTGTGACCACCTTATATCATTGGGAAATGACAAGAAAGAGAA...

CDS

Download CDS FASTA

921 bp · LXL04_011906|LXL04_011906|OH1004|CDS

ATGGCGATAGATCTCTCAGTTCTTCTTGTTTTGGTGTTTACCTGTTGTTTATCGAGCTGTTCTGCAGAAAGCCGAAAGGAACTCAGAACCAAAGAGAATGTTATACAATTAGGCCATCACCATGCACTTCCACCCAACACAATTGACCCATCACGAGTTACTCAACTCTCTTGGCGCCCAAGGGTATTCTTGTACAAAGGTTTCCTATCTGATGAAGAGTGTGACCACCTTATATCATTGGGAAATGACAAGAAAGAGAA...

Protein

Download Protein FASTA

306 aa · LXL04_011906|LXL04_011906|OH1004|PROTEIN

MAIDLSVLLVLVFTCCLSSCSAESRKELRTKENVIQLGHHHALPPNTIDPSRVTQLSWRPRVFLYKGFLSDEECDHLISLGNDKKEKLSGNNSTKSVGQTTNLDISLESEDEIITRIEERVSAWTFLPKVNGKPFHIFHIGPEEIKENQNYMSHTFMPPGKSLQATIIMYLSNITQGGHIIFPQAELGKSKVKSKISNDCTKSSEITKPMKGDAILFFNLHPNTSLDPSSMHARCPVVEGDMWWATKIFVVNSKAIKMKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011906`
TK1151 ID	TkA02G604900
OH-1004 ID	LXL04_011906
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011906

Location Chr03:2558443-2560709 (+)

Description Similar to P4H12: Probable prolyl 4-hydroxylase 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g25600`	Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in proline-rich peptide sequences of plant glycoproteins and other proteins.	No verified direct reference in this release
`At3g28490`	Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in proline-rich peptide sequences of plant glycoproteins and other proteins.	No verified direct reference in this release
`At3g28480`	Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in proline-rich peptide sequences of plant glycoproteins and other proteins.	No verified direct reference in this release
`At5g18900`	Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in proline-rich peptide sequences of plant glycoproteins and other proteins.	No verified direct reference in this release
`At3g06300`	Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in proline-rich peptide sequences of plant glycoproteins and other proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011906 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0018401 peptidyl-proline hydroxylation to 4-hydroxy-L-proline Biological Process

GO:0080147 root hair cell development Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT3G06300

ath:AT3G28480

ath:AT3G28490

ath:AT4G25600

ath:AT5G18900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.217

Rank 1 · LXL04_011906 · OH-1004

Lysosome / Vacuole0.190

Rank 2 · LXL04_011906 · OH-1004

Endoplasmic reticulum0.188

Rank 3 · LXL04_011906 · OH-1004

Golgi apparatus0.151

Rank 4 · LXL04_011906 · OH-1004

Cytoplasm0.132

Rank 5 · LXL04_011906 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GXT7`	Arabidopsis thaliana	Probable prolyl 4-hydroxylase 12	45.079%	Swiss-Prot	moderate database homology
`F4J0A8`	Arabidopsis thaliana	Probable prolyl 4-hydroxylase 6	43.223%	Swiss-Prot	moderate database homology
`Q8L970`	Arabidopsis thaliana	Probable prolyl 4-hydroxylase 7	42.857%	Swiss-Prot	moderate database homology
`Q8LAN3`	Arabidopsis thaliana	Probable prolyl 4-hydroxylase 4	40.727%	Swiss-Prot	moderate database homology
`F4JAU3`	Arabidopsis thaliana	Prolyl 4-hydroxylase 2	37.778%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card