LXL04_011867 | RubberDandelionOmics

Gene overview

LXL04_011867

Reference: OH-1004 Chr: Chr03 Coordinates: 1834619-1836025 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1407 bp · LXL04_011867|LXL04_011867|OH1004|cDNA

ATGGATTCCGGTATGGTGGTTCTGTATCCTTCTCCGGGGATAGGCCACTTGGTTTCCATGGTAGAGCTCGGGAAACTCATCCACATCCACCACCCTTCACTCTCTGTCACCATCATCATAACTCCGGCACCTTTCGAAACCGGCTCCACCGACAAATACATCAAAACCGTCTCCTTCACCAACCCTTCCATAACGTTCCACCATCTCCCCGCCGCCGTTATTCCACCGGACTTCTCTTCTGACTTCATAGACCTTGCTTT...

CDS

Download CDS FASTA

1407 bp · LXL04_011867|LXL04_011867|OH1004|CDS

ATGGATTCCGGTATGGTGGTTCTGTATCCTTCTCCGGGGATAGGCCACTTGGTTTCCATGGTAGAGCTCGGGAAACTCATCCACATCCACCACCCTTCACTCTCTGTCACCATCATCATAACTCCGGCACCTTTCGAAACCGGCTCCACCGACAAATACATCAAAACCGTCTCCTTCACCAACCCTTCCATAACGTTCCACCATCTCCCCGCCGCCGTTATTCCACCGGACTTCTCTTCTGACTTCATAGACCTTGCTTT...

Protein

Download Protein FASTA

468 aa · LXL04_011867|LXL04_011867|OH1004|PROTEIN

MDSGMVVLYPSPGIGHLVSMVELGKLIHIHHPSLSVTIIITPAPFETGSTDKYIKTVSFTNPSITFHHLPAAVIPPDFSSDFIDLAFGIPEFNNPIVHDTLVTFSRKSTIKAVVLDFFSNAAFQISTGLKIPTYYFYTSGASGLCAFLYLATIDKTTSDSFKDLNISFDIPGVPPVHSSDMPTSWSDRETNSYKKFIDTANNMAKSSGLVVNTFAGLEERAVDALREGKCVVEGPTPPVYFIGPLIAEGNHGDLKEDECL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011867`
TK1151 ID	TkA02G606910
OH-1004 ID	LXL04_011867
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	84.300
Protein coverage (%)	TK1151 100.000 / OH-1004 99.145 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011867

Location Chr03:1834619-1836025 (-)

Description Similar to UGT88B1: UDP-glycosyltransferase 88B1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16520`	Possesses low quercetin 3-O-glucosyltransferase, 7-O-glucosyltransferase, 3'-O-glucosyltransferase and 4'-O-glucosyltransferase activities in vitro.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011867 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016757 glycosyltransferase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0050004 isoflavone 7-O-glucosyltransferase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function

GO:0080045 quercetin 3'-O-glucosyltransferase activity Molecular Function

GO:0080046 quercetin 4'-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ag:BAD99560

ath:AT3G16520

gmx:100101902

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.791

Rank 1 · LXL04_011867 · OH-1004

Nucleus0.222

Rank 2 · LXL04_011867 · OH-1004

Endoplasmic reticulum0.073

Rank 3 · LXL04_011867 · OH-1004

Peroxisome0.062

Rank 4 · LXL04_011867 · OH-1004

Plastid0.056

Rank 5 · LXL04_011867 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201.25UDPGT257-429 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011867	`PF00201.25`	UDPGT	257	429	4.9e-23	82.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LK73`	Arabidopsis thaliana	UDP-glycosyltransferase 88A1	49.156%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card