LXL04_011854 | RubberDandelionOmics

Gene overview

LXL04_011854

Reference: OH-1004 Chr: Chr03 Coordinates: 1575364-1580454 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4380 bp · LXL04_011854|LXL04_011854|OH1004|cDNA

ATGGCTAATCTATGGAGTTCCTTTTGCGGGTGTTCCAGCAATGACAAAAATTGTGATCAAGATTTGATTTTTATCACAAATCCTTCTTCGTGTATGAATCATGTTCTACTCATTTGTTTCGATTTATTACTCCTCGCCATGTTACTCCTCTCCATTCTTTACAAATCACCATCAAAATACACCCAAAGATCATCTCTTTTTCACCGGAAATCACGTTTACAGTTAATTTCGGCAATCTTTAACAGTTTACTGGGAACACT...

CDS

Download CDS FASTA

4380 bp · LXL04_011854|LXL04_011854|OH1004|CDS

ATGGCTAATCTATGGAGTTCCTTTTGCGGGTGTTCCAGCAATGACAAAAATTGTGATCAAGATTTGATTTTTATCACAAATCCTTCTTCGTGTATGAATCATGTTCTACTCATTTGTTTCGATTTATTACTCCTCGCCATGTTACTCCTCTCCATTCTTTACAAATCACCATCAAAATACACCCAAAGATCATCTCTTTTTCACCGGAAATCACGTTTACAGTTAATTTCGGCAATCTTTAACAGTTTACTGGGAACACT...

Protein

Download Protein FASTA

1459 aa · LXL04_011854|LXL04_011854|OH1004|PROTEIN

MANLWSSFCGCSSNDKNCDQDLIFITNPSSCMNHVLLICFDLLLLAMLLLSILYKSPSKYTQRSSLFHRKSRLQLISAIFNSLLGTLYICLGIWTLKTTILPLHQWITFLFHGVTWLTVSLTVSLTGKHFPKTPVRLLSIASVLFTGFFGALSILNNSMSIKVAMDTTSFLGSLLLLACTYKGFNYEEINNNNNGLYTPLTNGIKENYQENLTPLANAGFLNVMSFWWLNPLMKTGSQKTLEEKDMPKLRTQDRAEFCYS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011854`
TK1151 ID	TkA02G607900
OH-1004 ID	LXL04_011854
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 99.513 / OH-1004 84.099 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011854

Location Chr03:1575364-1580454 (+)

Description Similar to ABCC10: ABC transporter C family member 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g59140`	Pump for glutathione S-conjugates.	No verified direct reference in this release
`At3g21250`	Pump for glutathione S-conjugates.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0142800`	ABC transporter that may affect phytic acid transport and compartmentalization.	Mutations of the multi-drug resistance-associated protein ABC transporter gene 5 result in reduction of phytic acid in rice seeds.2009 · DOI: 10.1007/s00122-009-1018-1
`UniProt: A2XCD4`	ABC transporter that may affect phytic acid transport and compartmentalization.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011854 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0055085 transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0008559 ABC-type xenobiotic transporter activity Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0042626 ATPase-coupled transmembrane transporter activity Molecular Function

GO:0140359 ABC-type transporter activity Molecular Function

KEGG gene cross-reference

ath:AT3G21250

ath:AT3G59140

dosa:Os03g0142800

zma:100125659

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.370

Rank 1 · LXL04_011854 · OH-1004

Lysosome / Vacuole0.299

Rank 2 · LXL04_011854 · OH-1004

Endoplasmic reticulum0.165

Rank 3 · LXL04_011854 · OH-1004

Cytoplasm0.144

Rank 4 · LXL04_011854 · OH-1004

Golgi apparatus0.093

Rank 5 · LXL04_011854 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24358.2ABCC10_N1-186 aa

PF00664.29ABC_membrane288-556 aa

PF00005.34ABC_tran622-756 aa

PF00664.29ABC_membrane898-1148 aa

PF00005.34ABC_tran1230-1378 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011854	`PF24358.2`	ABCC10_N	1	186	4.1e-61	206.7
LXL04_011854	`PF00664.29`	ABC_membrane	288	556	6.6e-45	154.6
LXL04_011854	`PF00005.34`	ABC_tran	622	756	3.6e-48	164.4
LXL04_011854	`PF00664.29`	ABC_membrane	898	1148	6.6e-45	154.6
LXL04_011854	`PF00005.34`	ABC_tran	1230	1378	3.6e-48	164.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYS2`	Arabidopsis thaliana	ABC transporter C family member 10	64.315%	Swiss-Prot	strong database homology
`Q8LGU1`	Arabidopsis thaliana	ABC transporter C family member 8	43.300%	Swiss-Prot	moderate database homology
`Q10RX7`	Oryza sativa subsp. japonica	ABC transporter C family member 13	45.482%	Swiss-Prot	moderate database homology
`A2XCD4`	Oryza sativa subsp. indica	ABC transporter C family member 13	45.482%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card